DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9125 and cuff

Sequence 1:NP_996492.1 Gene:CG9125 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_610709.1 Gene:cuff FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster

Alignment Length:401 Identity:92/402 (23%)
Similarity:164/402 (41%) Gaps:81/402 (20%)


  Fly    15 HKLGAMYNTPFPSISRPKCIGVCSINASREFVDDASCASYLAGQPWPPLPFDLNGGIEDVIRKPV 79
            |......|..||:|::|...|..:.:...:|..::....|:...|....|..|.  .:|...|..
  Fly    13 HSWAEKDNLVFPTITKPVSNGWFAWSPIGQFEPNSQKVPYVVVPPSIKFPISLR--YKDSPPKLE 75

  Fly    80 ENGKRDLEIMLTYIKQHQKELLRQSSS-------DARNLRLDSDFVTLRGILRQIMCLQYDNRS- 136
            :.....|:.||.||         :|||       :.:..:|:::.|....:|..:||..|:.:: 
  Fly    76 KKPNIFLDNMLQYI---------ESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTG 131

  Fly   137 FRVKATLLNGNVYMCK--EETPEQQLENANMSRAQ--------RVMCSW--GFKFEQYLTSAQAQ 189
            :.:..|.....:|:|:  .|.|: .::..|:.||.        |..|.:  |.|..|:..|::  
  Fly   132 WSLGVTRYRNTMYICRIDVEQPD-PIDQDNLKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSE-- 193

  Fly   190 GKPVTNVPVNEAEEFMGVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLDS-LKFVELKTSVF 253
                      |...|.||:..:|.|..:|:       ||....:.....:..| |.:|:|:....
  Fly   194 ----------EHLRFHGVFSFDLNGNRVLF-------DSPVLAEMPSTTLNGSALSWVDLQIRPM 241

  Fly   254 NMN----PHQIRTFKSFKSANWWSQSFLVGITTLYVGLRDTKGMLQRIDEIDVATLARN------ 308
            .|:    |...||    ::..||.:.||:||.:||:..||....:..|::    ||.|:      
  Fly   242 FMSRLDWPEHNRT----EALKWWVKCFLLGIESLYIARRDENAHVHNIEK----TLVRDLWKSCE 298

  Fly   309 KPWSASAMAWYLEQFLRNLKKLLVNINDPFAVVQVTF--LNKHASYEVLRG-PEHQILPNWYR-- 368
            |.||.:..|.::...|..:.:::..|:.|..|....|  .....||:.||| .::..:.:|:|  
  Fly   299 KDWSPTVCANFMIYLLNCISQVMAPIDCPSTVYLFQFDASQGTVSYKGLRGRNQYTFVSDWFRMM 363

  Fly   369 ------DLLKT 373
                  |:.||
  Fly   364 LDDHTNDMCKT 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9125NP_996492.1 RAI1 224..296 CDD:285815 20/77 (26%)
cuffNP_610709.1 RAI1 <257..284 CDD:285815 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167453537
eggNOG 1 0.900 E1_KOG1982
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1034620at2759
OrthoFinder 1 1.000 FOG0002356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12395
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.