DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9125 and din1

Sequence 1:NP_996492.1 Gene:CG9125 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_594904.1 Gene:din1 PomBaseID:SPAC19D5.06c Length:352 Species:Schizosaccharomyces pombe

Alignment Length:350 Identity:94/350 (27%)
Similarity:156/350 (45%) Gaps:69/350 (20%)


  Fly    19 AMYNTP---FPSISRPKCIGVCSINASREFVDDASCASYLAGQPWPPLPFDLNGGIEDVIRKPVE 80
            :.|:.|   .|.:|.|..|...|::..||.:.|.|..||.  .| |||..|||.|..:....|  
pombe     6 SFYDVPPAHVPPVSEPLEIACYSLSRDRELLLDDSKLSYY--YP-PPLFSDLNTGFPNRFHPP-- 65

  Fly    81 NGKRD---LEIMLTYIKQHQKELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNRSFRVKAT 142
              |.|   :.|:        |::|.     .:.::::|.|:|.||::.:|||...|.|:......
pombe    66 --KSDPDPISIV--------KDVLM-----TKGIQMNSSFLTWRGLITKIMCAPLDPRNHWETYL 115

  Fly   143 LL---NGNVYMCKEETPEQQLENANMSRAQRVMCSWGFKFEQYLT-------SAQAQGKPVTNVP 197
            ::   :|.:.|  ||....:...||..|    ||.||:|||...|       .::.|.:...|..
pombe   116 VMDPTSGIIMM--EERTRSETSYANQDR----MCYWGYKFEAISTLPEIWDACSRDQIEQRDNQD 174

  Fly   198 VNEAEEFMGVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLD---------------SLKFVE 247
            |...|::..:.:.|:....::...|:||:..|:|...|:..|..               :|.:||
pombe   175 VVPDEQYCSIVKINIGKSKLILAGEVDCIWDKKPCSAKESDVHSDDGTIEEDASNAENPNLHYVE 239

  Fly   248 LKTS-VFNMNPHQIRTFKSFKSANWWSQSFLVGITTLYVGLRDTKGMLQRIDEI---DVATLARN 308
            |||| .:.:..:.:|.    |...:|:||||:||..:.:|.||..|:|..:.|:   .:..:.|.
pombe   240 LKTSKKYPLENYGMRK----KLLKYWAQSFLLGIGRIIIGFRDDNGILIEMKELFTHQIPKMLRP 300

  Fly   309 --KP--WSASAMAWYLEQFLRNLKK 329
              ||  |:.:.:...||..|..:|:
pombe   301 YFKPNDWTPNRLLVVLEHALEWIKQ 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9125NP_996492.1 RAI1 224..296 CDD:285815 27/88 (31%)
din1NP_594904.1 RAI1 200..283 CDD:285815 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H38061
Inparanoid 1 1.050 89 1.000 Inparanoid score I1735
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002356
OrthoInspector 1 1.000 T1125768
orthoMCL 1 0.900 OOG5_129679
Panther 1 1.100 LDO PTHR12395
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R331
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.