DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9125 and M01G12.14

Sequence 1:NP_996492.1 Gene:CG9125 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_493058.1 Gene:M01G12.14 WormBaseID:WBGene00010825 Length:350 Species:Caenorhabditis elegans

Alignment Length:343 Identity:69/344 (20%)
Similarity:131/344 (38%) Gaps:102/344 (30%)


  Fly    39 INASREFVDDASCASYLAGQPWPPLPFDLNGGIEDVIRKPVEN--GKRDLEIMLTYIKQ----HQ 97
            :|.::::::|            |.|||.    ..||..|..:|  |::.:|.:|:|:.|    ::
 Worm    28 LNENKKYLED------------PTLPFP----YVDVQLKVPDNGGGEKHMESVLSYLNQMGWPNK 76

  Fly    98 KELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNR--SFRVKATLLNGNVYMCKEE-----T 155
            |:               .||||.|..:..|....:.::  :.|:.....:|.:::.|..     |
 Worm    77 KK---------------PDFVTNRHTITTIATTGFSSKEQAQRLLIFRYSGVIFLLKSSEFDDLT 126

  Fly   156 PEQQLENANMSRAQRVMCSWGFKFEQYLTSAQAQGKPVTNVPVNEAEEFMGVYRTNLAGILMLYG 220
            |:              :.::..|||.:......:.....:..|.:|.....:.|.|.....:||.
 Worm   127 PD--------------ILNYAIKFEHFFKKTSDEEPVGGDGTVRKAVFKATIPRGNEHPYSVLYS 177

  Fly   221 AELDCVDSKEPVDFKDCRVLDSLKFVELKTSVFNMNPHQIRTFKSFKSANWWSQSFLVGITTLYV 285
            .|:|.:..:|           |.:.||||..|..::.::.:    |:|...:.|:|...:.||.:
 Worm   178 GEMDAIYDEE-----------SREHVELKVFVNGLDNYKWK----FRSCWMYWQAFFSNVPTLVI 227

  Fly   286 GLRDTK-----------------GMLQRIDEIDVATLARN-----------KPWSASAMAWYLEQ 322
            |.|..|                 ..|:| |.|.....|::           |.||.:|...:|..
 Worm   228 GSRTGKEYQSISKHIPGFSLYKVEKLER-DSIPSTAAAKHAQRMGDRPFPPKIWSVAAGERHLRV 291

  Fly   323 FLRNLKKLLVNINDPFAV 340
            ||:.:|:..::..|.|.:
 Worm   292 FLQLVKETAISDGDCFVL 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9125NP_996492.1 RAI1 224..296 CDD:285815 18/89 (20%)
M01G12.14NP_493058.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.