DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9125 and Y47H10A.4

Sequence 1:NP_996492.1 Gene:CG9125 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_493055.1 Gene:Y47H10A.4 WormBaseID:WBGene00012960 Length:327 Species:Caenorhabditis elegans

Alignment Length:376 Identity:81/377 (21%)
Similarity:133/377 (35%) Gaps:107/377 (28%)


  Fly    15 HKLGAMYNTP--FPSISRPKCIGVCSINASREFVDDASCASYLAGQPWPPLP---FDLNGGIEDV 74
            |:.|.|..||  .|.|...:|:                          .||.   |:||..:.| 
 Worm    13 HRDGDMRVTPGLLPKILNRECL--------------------------KPLREDFFNLNIEVPD- 50

  Fly    75 IRKPVENGKRDLEIMLTYIKQHQKELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNRSFRV 139
                ...|:.::...|.||.|      .:...||:     .||||    .:||:.....|:.|.:
 Worm    51 ----SGQGENNMVSFLDYISQ------TKCLEDAQ-----PDFVT----NKQILTALTGNKPFTI 96

  Fly   140 KATLLNGNVYMCKE-ETPEQQLENANMSRAQRVMCSWGFKFEQYLTSAQAQGKPVTNVPVNEAEE 203
            .|..|.|.::..|. |...|..:|            :|..||.:.|..:...:..|:..|.:|..
 Worm    97 HAIHLKGTIFSFKSGEVRYQDTKN------------FGGAFEHFCTRTRNDEQLETDDTVRKAVF 149

  Fly   204 FMGVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLDSLKFVELKTSVFNMNPHQIRTFKSFKS 268
            ...:.|.|.....:||..::|.:|::  ||         .|..|||.....:|.:    |...||
 Worm   150 KAEIPRGNTQFYRVLYSGQIDAIDNE--VD---------RKHYELKIMSQGLNEY----FWKEKS 199

  Fly   269 ANWWSQSFLVGITTLYVGLRDTKGMLQ-----------RIDEI------DVATLARNKPWS-ASA 315
            ..::.||.......|.:|.|..:...|           :::|:      .:|...|..|.. ..|
 Worm   200 CKFYWQSVFGNAPVLIIGSRSGQYSTQTTNNYPPYSLYKVEELKRDRIPSMAARCRKIPGRFGPA 264

  Fly   316 MAWYLEQ-------FLRNLKKLLVNINDPFAVVQVTFLNKHASYEVLRGPE 359
            ..|.:.:       ||..:|..::|..|.|:   .|..:::..::|.|..|
 Worm   265 PPWKISEGEDNALYFLDLVKDNVINDGDCFS---FTRTDENPDWDVKRDEE 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9125NP_996492.1 RAI1 224..296 CDD:285815 18/83 (22%)
Y47H10A.4NP_493055.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.