DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9125 and Dxo

Sequence 1:NP_996492.1 Gene:CG9125 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001157242.1 Gene:Dxo MGIID:1890444 Length:397 Species:Mus musculus

Alignment Length:380 Identity:103/381 (27%)
Similarity:171/381 (45%) Gaps:48/381 (13%)


  Fly    15 HKL----------GAMYNTPFPSISRPKCIGVCSINASREFVDDASCASYLAGQP--WPPLPFDL 67
            |||          .::|:.|||...||..:|..|::|.|::..||....|.:..|  .|...|||
Mouse    20 HKLPRAVPLLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPINGPGPDFDL 84

  Fly    68 NGGIEDVIRKPVENGKRDLEIMLTYIKQHQKELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQY 132
            ..|..|..:...|..:..|:.:|.::.:|:.:|      :.....|....||.||.|.:::...|
Mouse    85 RDGYPDRYQPRDEEVQERLDHLLRWVLEHRNQL------EGGPGWLAGATVTWRGHLTKLLTTPY 143

  Fly   133 DNR-SFRVKATLLNGNVYMCKEETPEQQLENANMSRAQRVMCSWGFKFEQYLTSAQAQGKPVTNV 196
            :.: .:::.|:...|.:|:.:.|||..:.:........|.:...|:|||||:.:.:..|.|..:.
Mouse   144 ERQEGWQLAASRFQGTLYLSEVETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGGSPDPSG 208

  Fly   197 PVNEAEEFMGVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLDSLKFVELKTSVFNMNPHQIR 261
            .||....:..|.|:.|....:|:..|:||::.:.|     |....|. :||||||....:|.|.|
Mouse   209 EVNTNVAYCSVLRSRLGNHPLLFSGEVDCLNPQAP-----CTQPPSC-YVELKTSKEMHSPGQWR 267

  Fly   262 TFKSFKSANWWSQSFLVGITTLYVGLRDTKGM---LQRIDEIDVATLARN--KPWSASAMAWYLE 321
            :|...|...||:||||.|:..:..|.|:.:|.   |:....:::....||  :.|:.|....:..
Mouse   268 SFYRHKLLKWWAQSFLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSVCMNFCA 332

  Fly   322 QFLRNLKKLLVNINDPFAVVQVTFLNKHA-SYE--------VLRGPEHQILPNWY 367
            .||...:..:|. :||..|        |. |:|        |.|...:..||:||
Mouse   333 AFLSFAQSTVVQ-DDPRLV--------HLFSWEPGGPVTVSVHRDAPYAFLPSWY 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9125NP_996492.1 RAI1 224..296 CDD:285815 27/75 (36%)
DxoNP_001157242.1 RAI1 235..302 CDD:285815 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167482440
eggNOG 1 0.900 E1_KOG1982
Hieranoid 1 1.000
Homologene 1 1.000 H38061
Inparanoid 1 1.050 123 1.000 Inparanoid score I4682
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002356
OrthoInspector 1 1.000 T1085185
orthoMCL 1 0.900 OOG5_129679
Panther 1 1.100 LDO PTHR12395
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R331
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.