DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33223 and CG32713

DIOPT Version :9

Sequence 1:NP_001285021.1 Gene:CG33223 / 2768867 FlyBaseID:FBgn0053223 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001285020.1 Gene:CG32713 / 318166 FlyBaseID:FBgn0052713 Length:184 Species:Drosophila melanogaster


Alignment Length:184 Identity:179/184 - (97%)
Similarity:180/184 - (97%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRKVQALVQTRDGKKTVYEVDRLGTVASLKARIGQAMSVPMGFSRLSYKGRVLSNQSVLEDLGPN 65
            |||||.|||||||||||||||||||||||||||||.|||||||||||||||||||||||||||||
  Fly     1 MRKVQVLVQTRDGKKTVYEVDRLGTVASLKARIGQVMSVPMGFSRLSYKGRVLSNQSVLEDLGPN 65

  Fly    66 KSTLDLTWKPVVLTANQSSKLSKFGYGRIDDSEVMFTLIGGYQQREEYPGGIVNPPDDESQQNFN 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||.|||
  Fly    66 KSTLDLTWKPVVLTANQSSKLSKFGYGRIDDSEVMFTLIGGYQQREEYPGGLVNPPDDESQLNFN 130

  Fly   131 AGDDDDALEAQDMTGHDLSSIQTDDLSLKGQTEPELDCSIGSHGFSGSQEEGQE 184
            ||||||||||||||||||||||||||||||||||||||||||||||||||||.|
  Fly   131 AGDDDDALEAQDMTGHDLSSIQTDDLSLKGQTEPELDCSIGSHGFSGSQEEGHE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33223NP_001285021.1 UBQ 4..71 CDD:214563 64/66 (97%)
UBQ 10..71 CDD:294102 59/60 (98%)
CG32713NP_001285020.1 UBQ 4..71 CDD:214563 64/66 (97%)
UBQ 10..71 CDD:294102 59/60 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.