DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and PLG

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_000292.1 Gene:PLG / 5340 HGNCID:9071 Length:810 Species:Homo sapiens


Alignment Length:262 Identity:81/262 - (30%)
Similarity:119/262 - (45%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DCGTTR-HPSRI-RRVVGGNDADRFANPWMVMVLGENNV-FCSGSLITRLFVLTSASCLLSLPK- 104
            |||..: .|.:. .|||||..|...:.||.|.:.....: ||.|:||:..:|||:|.||...|: 
Human   566 DCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRP 630

  Fly   105 ---QVILGEYDRNCTSADCTSIRQVIDID---QKIIHGQFGLETVKKYDIALLRLAKKVSISDYV 163
               :||||.:             |.::::   |:|...:..||..:| |||||:|:....|:|.|
Human   631 SSYKVILGAH-------------QEVNLEPHVQEIEVSRLFLEPTRK-DIALLKLSSPAVITDKV 681

  Fly   164 RPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGR--LRQNIDASQLCV 226
            .|.||.....|.........||||.|:....:.:|:...|..|..|.|...  |...:.:::||.
Human   682 IPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCA 746

  Fly   227 G--GPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSC--SGIGVYTNVEHYMD 287
            |  ....|:|.||:||||...          .|.:..|.|:.|:|....  :..|||..|..::.
Human   747 GHLAGGTDSCQGDSGGPLVCF----------EKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVT 801

  Fly   288 WI 289
            ||
Human   802 WI 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 75/246 (30%)
Tryp_SPc 57..292 CDD:238113 76/247 (31%)
PLGNP_000292.1 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..145
KR 183..263 CDD:214527
KR 273..354 CDD:214527
KR 375..456 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..416
KR 479..560 CDD:214527
Tryp_SPc 580..803 CDD:214473 75/246 (30%)
Tryp_SPc 581..804 CDD:238113 76/247 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.