DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and cela1.2

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:289 Identity:81/289 - (28%)
Similarity:131/289 - (45%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IVLLASLVLGARLGSSTLLTNDCGTTRHPSRI----RRVVGGNDADRFANPWMVMV--LGENNVF 81
            :::||:.||             ||...:..|:    .||:||.:..|.:.||.|.:  |...:.:
 Frog     4 LLVLAAFVL-------------CGQCSNDIRLIEDHERVIGGTEVQRNSWPWQVSLQYLSGGSWY 55

  Fly    82 --CSGSLITRLFVLTSASCL-LSLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETV 143
              |.||||....|||:|.|: .::..:|::|  |.|....|.|  .|.|.:.:.:.|..:....:
 Frog    56 HTCGGSLIRANRVLTAAHCVDRAVSYRVVVG--DHNIYQNDGT--EQYISVSRIVKHANWNPNNI 116

  Fly   144 KK-YDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWN-EPSTILQTVTLSKI 206
            .. |||::|.|:...:::.||:...|..|..|.....:...||||.|..| ..:::||...|..|
 Frog   117 AAGYDISILHLSSSATLNSYVKLAQLPADNVVLAHNYNCVVTGWGKTSNNGNLASVLQQAPLPVI 181

  Fly   207 NRKYCK--GRLRQNIDASQLCVGGPR-KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSY 268
            ....|.  ......:.::.:|.||.. :..|.||:||||:..:    :|.:.      :.|:.|:
 Frog   182 AHSTCSSGSYWGSTVKSTMVCAGGDGVRSGCQGDSGGPLNCPV----NGVYQ------VHGVTSF 236

  Fly   269 GSSS-CSGI---GVYTNVEHYMDWIVRTI 293
            .||| ||..   .|:|.|..|:.||...|
 Frog   237 VSSSGCSTYLKPTVFTRVSAYIGWINNNI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 71/246 (29%)
Tryp_SPc 57..292 CDD:238113 72/248 (29%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.