DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CLIPB18

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_001238237.1 Gene:CLIPB18 / 4578288 VectorBaseID:AGAP009215 Length:359 Species:Anopheles gambiae


Alignment Length:278 Identity:89/278 - (32%)
Similarity:134/278 - (48%) Gaps:33/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWM-VMVLGENNVFCSGSLITRLFVLTSASCL 99
            |.:||...:||.    ....|:..|.:|..|..||| :::|......|.|:||.|.:|||:|.||
Mosquito    97 GLATLDLEECGA----YSADRMAYGQEARLFQFPWMALLMLNSVKFVCGGTLINRRYVLTAAHCL 157

  Fly   100 LSLPKQVI-LGEYDRNCTSADC-------TSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKK 156
            .:.....: |||:|.: |..|.       ....|.|.|:|.|:|..:... :|..||.|:|:|::
Mosquito   158 KNTQVTTVRLGEFDIS-TPIDYDKRGDQHAPPPQDIAIEQTIVHEAYSTR-LKVNDIGLIRMAEE 220

  Fly   157 VSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLRQ---- 217
            .:.:|.|.||||.|...:..:...:...|||.||....|..|....::.:....|...|.:    
Mosquito   221 AAYNDNVSPICLPVSPAMRTTQTTYFVAGWGATESAFYSNRLLFGKVALLTNDQCAQHLLRVDSY 285

  Fly   218 -NIDASQLC-VGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSC---SGIG 277
             .|:..|:| :|....|.|:||:||||. |:.|:        :|....|:||.|..:|   |..|
Mosquito   286 TKINNDQMCAIGANLTDNCTGDSGGPLK-TISIN--------ARYVQYGVVSLGLRTCGKQSAPG 341

  Fly   278 VYTNVEHYMDWIVRTINK 295
            |||.||:|.|||:..:.:
Mosquito   342 VYTRVENYADWILEHLEE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 82/250 (33%)
Tryp_SPc 57..292 CDD:238113 83/252 (33%)
CLIPB18XP_001238237.1 Tryp_SPc 117..356 CDD:238113 83/249 (33%)
Tryp_SPc 117..353 CDD:214473 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.