DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG5246

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:297 Identity:82/297 - (27%)
Similarity:140/297 - (47%) Gaps:51/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IVLLASLVLGARLGSSTL-------LTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVL---GE 77
            :||::.||:.::..:.::       |.:..|   |.....||:||.|:.....|:.|.::   ||
  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLG---HVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65

  Fly    78 NNVFCSGSLITRLFVLTSASCLLSLPKQ---VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFG 139
            :  .|.||:|...::||:|.| :..|.|   ::.|..|.....|:..       :|...||....
  Fly    66 H--VCGGSIIAPQWILTAAHC-MEWPIQYLKIVTGTVDYTRPGAEYL-------VDGSKIHCSHD 120

  Fly   140 LETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTE-WNEPSTILQTVTL 203
             :.....||||:..||.:...|..:||.|:....:.:.....|.||||:|: |...||.||.:.|
  Fly   121 -KPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDL 184

  Fly   204 SKINRKYCKGRLRQNIDASQLCVG------GPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFL 262
            :.|:...|:.|:|   :|:.|..|      ...:.:|.||:||||     :|.     |::   |
  Fly   185 NYIDHDNCQSRVR---NANWLSEGHVCTFTQEGEGSCHGDSGGPL-----VDA-----NQT---L 233

  Fly   263 IGIVSYGSSSCSGI-GVYTNVEHYMDWIVRTINKSNT 298
            :|:|::|.:...|. .|:.:|.:|.|||.:.:..:.|
  Fly   234 VGVVNWGEACAIGYPDVFGSVAYYHDWIEQMMTDAGT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 72/246 (29%)
Tryp_SPc 57..292 CDD:238113 73/248 (29%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/246 (29%)
Tryp_SPc 42..263 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.