DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG11668

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:282 Identity:73/282 - (25%)
Similarity:126/282 - (44%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SLVLGARLGSSTLLTNDCGTTRHPSRIRRVV--GGNDADRFANPWMVMVLGENNVFCSGSLITRL 90
            :|::|.||.........| ....|||..|.:  .|:...|:            ...|..::|...
  Fly   146 NLLVGGRLTQENEHPYMC-ALGWPSRTNRWIHEHGSSKRRY------------TFNCGCAMIAPR 197

  Fly    91 FVLTSASCLL---SLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLR 152
            |.:|:|.|..   ..|...::|..:.|      :...|:|:|.:...|..|..||:.. |:|:::
  Fly   198 FAITAAHCASVGGESPSVALIGGVELN------SGRGQLIEIKRISQHPHFDAETLTN-DLAVVK 255

  Fly   153 LAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEP--STILQTVTLSKINRKYCK--- 212
            ||::    .::...||.  .|.....:..||.|:|.|::..|  |.:|| :.|..:|.:.|:   
  Fly   256 LARR----SHMPVACLW--NQESLPERPLTALGYGQTKFAGPHSSNLLQ-IMLYHLNFQQCQRYL 313

  Fly   213 ---GRLRQNIDASQLCVG--GPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSS 272
               .:|...:.:.|:|.|  ....|||.||:||||.|...:    :.:..:..:::||.|:|.:.
  Fly   314 HNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHM----RHHRHTIPYVVGITSFGGAC 374

  Fly   273 CSG-IGVYTNVEHYMDWIVRTI 293
            .|| .|||..:.||:.||.:.:
  Fly   375 ASGQPGVYVRIAHYIQWIEQQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 63/248 (25%)
Tryp_SPc 57..292 CDD:238113 64/250 (26%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 72/276 (26%)
Tryp_SPc 149..392 CDD:214473 70/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.