DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG13318

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:289 Identity:80/289 - (27%)
Similarity:123/289 - (42%) Gaps:48/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSTLLTN------------DCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFC-SGSLIT 88
            ||||..:            .||....|...........|...|.||...:|...:|:. .|:|||
  Fly   131 SSTLTCSYGLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALIT 195

  Fly    89 RLFVLTSASCLLSLPK---QVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIAL 150
            ...|||:|..:.:|..   :|.|||:|...||....:  |.:.|....::..|....::. |:|:
  Fly   196 AQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPA--QDVYISNVYVNPSFNPNNLQN-DVAI 257

  Fly   151 LRLAKKVSIS--DYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEP---STILQTVTLSKINRKY 210
            |:|:..||::  ..|..:||.....||   |.....|||..::...   ..|.:.|.:..|....
  Fly   258 LKLSTPVSLTSKSTVGTVCLPTTSFVG---QRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNAN 319

  Fly   211 CKGRLRQN--------IDASQLCVGGPR-KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIV 266
            |:..|:..        ...|.:|.||.. ||.|:||.|.||..|    .:|.|      :::|:|
  Fly   320 CQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCT----SNGVW------YVVGLV 374

  Fly   267 SYG-SSSCSGI-GVYTNVEHYMDWIVRTI 293
            ::| ..:.:|: |||.||..|:.||..|:
  Fly   375 AWGIGCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 70/252 (28%)
Tryp_SPc 57..292 CDD:238113 72/254 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 72/248 (29%)
Tryp_SPc 169..399 CDD:214473 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.