DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Prss39

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006244779.1 Gene:Prss39 / 363215 RGDID:1309276 Length:371 Species:Rattus norvegicus


Alignment Length:292 Identity:66/292 - (22%)
Similarity:119/292 - (40%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPK 104
            :::..||.|:...:|   .||:.|.....||...::......|...||.:.:|.::|.|.....|
  Rat    58 IVSTVCGKTKFQGKI---YGGSIAKAERWPWQASLIFRGRHICGAVLIDKNWVASAAHCFKRSLK 119

  Fly   105 ----QVILG--------EYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKV 157
                :::||        .|.|..|            :.:.|:|..:.....::.||.|::|...|
  Rat   120 PSDYRILLGYNELSNPSNYSRQMT------------LSKVIVHEDYNKLHSQEKDIVLIQLHLPV 172

  Fly   158 SISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNE----PSTILQTVTLSKINRKYCKGRLR-- 216
            ..|.::.|:|:........|.:....:|||....::    |..:|.: .:..:|.:.|:...:  
  Rat   173 RYSSHIFPVCVPDQTTKEPSDESCWISGWGMVTDDKFLQAPFPLLDS-EVFLMNDQECEAFFQTP 236

  Fly   217 -------QNIDASQLCVGG--PRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSS 272
                   ..|....:|.|.  .:|.||.||:||||...|    |..|      :|:|:.|:..:.
  Rat   237 QISITEYDAIKDDMICAGDITNQKSTCRGDSGGPLVCLL----DSYW------YLVGLASWSGAC 291

  Fly   273 CSGI---GVYTNVEHYMDWIVRTINKSNTEKI 301
            ...|   .::|.|.|:.|||.:  .|::|..:
  Rat   292 LEPIHSPSIFTRVSHFSDWIEK--KKADTPDV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 58/262 (22%)
Tryp_SPc 57..292 CDD:238113 60/264 (23%)
Prss39XP_006244779.1 Tryp_SPc 71..311 CDD:214473 59/265 (22%)
Tryp_SPc 72..314 CDD:238113 61/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.