DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CG5390

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:273 Identity:78/273 - (28%)
Similarity:126/273 - (46%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGTTRHPSRIRRVVGG--NDADRFAN-PWMVMVL---GENNVF-CSGSLITRLFVLTSASCLLS- 101
            || .::|:.:...:.|  |....|.. |||:.:|   |..|:: |.|:||....|||:|.|:.: 
  Fly   135 CG-YQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK 198

  Fly   102 LPKQVIL--GEYDRNCTSADCTSIRQVID--IDQKIIHGQFGLETVKKYDIALLRLAKKVSISDY 162
            .|..:::  ||:|....    |.||:..|  :.:.|.|.||...::.. |:|::.|....::.:.
  Fly   199 QPSSIVVRAGEWDTQTQ----TEIRRHEDRYVKEIIYHEQFNKGSLYN-DVAVMLLESPFTLQEN 258

  Fly   163 VRPICLSVDRQVGR--SVQHFTATGWGTTEW---NEPSTILQTVTLSKINRKYCKGRLRQN---- 218
            ::.:||.   .||.  ......|||||..::   .|...||:.|.:..:..:.|:..||:.    
  Fly   259 IQTVCLP---NVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGR 320

  Fly   219 ---IDASQLCVGGPR-KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSGI--- 276
               :..|.:|.||.: ||||.||.|.||...:.       ..|:|....|||::| ..|..:   
  Fly   321 HFILHDSFICAGGEKDKDTCKGDGGSPLVCPIA-------GQKNRFKSAGIVAWG-IGCGEVNIP 377

  Fly   277 GVYTNVEHYMDWI 289
            |||.:|.....||
  Fly   378 GVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 73/260 (28%)
Tryp_SPc 57..292 CDD:238113 75/261 (29%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/254 (29%)
Tryp_SPc 153..390 CDD:214473 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.