| Sequence 1: | NP_001286682.1 | Gene: | CG33225 / 2768860 | FlyBaseID: | FBgn0053225 | Length: | 307 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_723920.1 | Gene: | CG31780 / 318937 | FlyBaseID: | FBgn0051780 | Length: | 464 | Species: | Drosophila melanogaster | 
| Alignment Length: | 249 | Identity: | 77/249 - (30%) | 
|---|---|---|---|
| Similarity: | 125/249 - (50%) | Gaps: | 40/249 - (16%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    69 PWMVMVLG--ENNVFCSGSLITRLFVLT--------SASCLLSLPKQVILGEYDRNCTSADCTSI 123 
  Fly   124 RQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICL-SVDRQVGRSVQHFTATGWG 187 
  Fly   188 TTEWNEPS--TILQTVTLSKINRKYCKGRLRQ------NIDASQLCVGG-PRKDTCSGDAGGPLS 243 
  Fly   244 LTLKIDGDGKWNNKSRAFLIGIVSYG-SSSCSGI-GVYTNVEHYMDWI-VRTIN 294 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG33225 | NP_001286682.1 | Tryp_SPc | 56..289 | CDD:214473 | 73/241 (30%) | 
| Tryp_SPc | 57..292 | CDD:238113 | 75/245 (31%) | ||
| CG31780 | NP_723920.1 | Tryp_SPc | 113..344 | CDD:214473 | 73/241 (30%) | 
| Tryp_SPc | 113..344 | CDD:238113 | 73/241 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||