DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Ovch2

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:312 Identity:80/312 - (25%)
Similarity:132/312 - (42%) Gaps:46/312 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EIVLLASLVL---GARLGSSTLLTNDCGTT-------RHPSRIRRVVGGNDADRFANPWMVMVLG 76
            :::|:..:|.   |.....|::...|||.:       .:.|...|:|||:..::.:.||.|.:..
  Rat     7 KLILILGIVCLEQGHSATLSSIRAPDCGKSLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQ 71

  Fly    77 ENNVFCSGSLITRLFVLTSASCL----LSLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQ 137
            :....|.|::|:..:|:|:|.|:    ::|...|..||:|.:.....    .|.:.|:..|||.|
  Rat    72 KQKHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPG----EQTLAIETIIIHPQ 132

  Fly   138 FGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWG-TTEWNEPSTILQTV 201
            |..:....||||||::........:|||:||....:...:....|..||| .:|......:||.|
  Rat   133 FSTKKPMNYDIALLKMVGTFQFGQFVRPVCLPEPGEQFNAGYICTTAGWGRLSEGGSLPQVLQQV 197

  Fly   202 TLSKINRKYCKG---RLRQNIDASQ-LCVGGP--RKDTCSGDAGGPLSLTLKIDGDGKWNNKSRA 260
            .|..:..:.|:.   .||..|.... ||.|.|  .:|.|.||:||.|...         |.|...
  Rat   198 NLPILTHEECEAVMLTLRNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQ---------NRKGAW 253

  Fly   261 FLIGIVSYG------------SSSCSGIGVYTNVEHYMDWIVRTINKSNTEK 300
            .|.|:.|:|            .......|::|::...:.||...:...:..|
  Rat   254 TLAGVTSWGLGCGRSWRNNARKKEQGSPGIFTDLRRVLPWIHEHVQTGHRRK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 69/255 (27%)
Tryp_SPc 57..292 CDD:238113 70/257 (27%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 70/257 (27%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.