DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and LOC286960

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:252 Identity:71/252 - (28%)
Similarity:113/252 - (44%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVILGEYDRNCTSADC 120
            ::|||....:...|:.|.:....:..|.||||:..:||::|.| .....||.|||::.:..... 
  Rat    23 KIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHC-YKRKLQVRLGEHNIHVLEGG- 85

  Fly   121 TSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPI-----CLSVDRQVGRSVQH 180
               .|.||.::.|.|.::..:|:.. ||.|::|.....::..|..:     |.|.|.|.      
  Rat    86 ---EQFIDAEKIIRHPEYNKDTLDN-DIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQC------ 140

  Fly   181 FTATGWGTTE--WNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLCV----GGPRKDTCSGDAG 239
             ..:|||.|.  ..:...:||.:....::...||......|.::..|:    ||  ||:|.||:|
  Rat   141 -LVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGG--KDSCDGDSG 202

  Fly   240 GPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCS---GIGVYTNVEHYMDWIVRTI 293
            ||:....:|.              ||||:| |.|:   ..||||.|.:|:.||..|:
  Rat   203 GPVVCNGEIQ--------------GIVSWG-SVCAMRGKPGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 68/246 (28%)
Tryp_SPc 57..292 CDD:238113 70/248 (28%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 68/246 (28%)
Tryp_SPc 24..243 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.