DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Pik3ip1

DIOPT Version :10

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_835362.2 Gene:Pik3ip1 / 216505 MGIID:1917016 Length:264 Species:Mus musculus


Alignment Length:40 Identity:11/40 - (27%)
Similarity:17/40 - (42%) Gaps:5/40 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 ISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTIL 198
            :|.:..|.|.:||...  .:.|...|   ..:..|.||:|
Mouse   221 LSAFTNPTCETVDENT--IIVHSNQT---PADVQEGSTLL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 11/40 (28%)
Pik3ip1NP_835362.2 KR 22..102 CDD:238056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.