DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and PRSS55

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:324 Identity:96/324 - (29%)
Similarity:147/324 - (45%) Gaps:65/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IVLLASLVLGARLGSST--------LLTNDCGTTR----HP----------------SRIRRVVG 59
            ::||.|||.|.:||..|        :|....|..|    ||                :|..|:.|
Human     6 VLLLLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFEGRTRYSRITG 70

  Fly    60 GNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLS---LPKQ--VILGEYDRNCTSAD 119
            |.:|:....||.|.:...:..||.||::.:.::||:|.||.|   .|::  |:||..|....|.:
Human    71 GMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLTSPSME 135

  Fly   120 CTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSV-QHFTA 183
               |::|..|   |:|..|....:.. |||||.||..:.:.|...||||..  |.|.:. :....
Human   136 ---IKEVASI---ILHKDFKRANMDN-DIALLLLASPIKLDDLKVPICLPT--QPGPATWRECWV 191

  Fly   184 TGWGTT---EWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPRK--DTCSGDAGGPLS 243
            .|||.|   :.|...|.|....:..::.:.| .::...:..:.||.|...:  |.|.||:||||.
Human   192 AGWGQTNAADKNSVKTDLMKAPMVIMDWEEC-SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLV 255

  Fly   244 LTLKIDGDGKWNNKSRAFLIGIVSYGSSSC---SGIGVYTNVEHYMDWIVRTINKS----NTEK 300
            .|.: .|: ||      :.:||:|:| .||   :..|:||::.:|..||.:.....    |.||
Human   256 CTPE-PGE-KW------YQVGIISWG-KSCGEKNTPGIYTSLVNYNLWIEKVTQLEGRPFNAEK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 76/246 (31%)
Tryp_SPc 57..292 CDD:238113 77/248 (31%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 76/246 (31%)
Tryp_SPc 68..298 CDD:238113 77/248 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.