DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:287 Identity:81/287 - (28%)
Similarity:117/287 - (40%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLL--SLPKQV 106
            ||| .:.||  .|:|||..:.....||...:.......|.|:||...:|:|:|.|..  |:...|
Human   558 DCG-LQGPS--SRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWVITAAHCFQEDSMASTV 619

  Fly   107 I----LGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPIC 167
            :    ||:..:|.......|.:    :.:.::| .:..|....||:|||:|...|..|..|||:|
Human   620 LWTVFLGKVWQNSRWPGEVSFK----VSRLLLH-PYHEEDSHDYDVALLQLDHPVVRSAAVRPVC 679

  Fly   168 LSVDRQVGRSVQHFTATGWGTTE--------------WNEP---------STILQTVTLSKINRK 209
            |...........|...||||...              |...         |..||.|.:..|.:.
Human   680 LPARSHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQD 744

  Fly   210 YCKGRLRQNIDASQLCVG--GPRKDTCSGDAGGPL---SLTLKIDGDGKWNNKSRAFLIGIVSYG 269
            .|....|..:....||.|  ..:||.|.||:||||   :|:      |:|      ||.|:||:|
Human   745 LCSEVYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALS------GRW------FLAGLVSWG 797

  Fly   270 SSSC---SGIGVYTNVEHYMDWIVRTI 293
             ..|   :..||||.:...:.||.:.:
Human   798 -LGCGRPNYFGVYTRITGVISWIQQVV 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 74/269 (28%)
Tryp_SPc 57..292 CDD:238113 75/271 (28%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486
Tryp_SPc 568..822 CDD:238113 75/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.