DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and Hgf

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001276387.1 Gene:Hgf / 15234 MGIID:96079 Length:728 Species:Mus musculus


Alignment Length:269 Identity:69/269 - (25%)
Similarity:114/269 - (42%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPK----- 104
            |..|:.    .|||.|........ |||.:...|...|.||||...:|||:..|..:..|     
Mouse   488 CAKTKQ----LRVVNGIPTQTTVG-WMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDY 547

  Fly   105 QVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLS 169
            :..||.:|.:....:  ..:|:::|.| :::|..|      .|:.||:||:...:.::|..|.|.
Mouse   548 EAWLGIHDVHERGEE--KRKQILNISQ-LVYGPEG------SDLVLLKLARPAILDNFVSTIDLP 603

  Fly   170 VDRQVGRSVQHFTAT---GWGTTEWNEPSTILQTVTLSKINRKYC----KGRLRQNIDASQLCVG 227
               ..|.::...|..   |||.|.......:|:...|..:..:.|    :|::  .::.|:||.|
Mouse   604 ---SYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKV--TLNESELCAG 663

  Fly   228 ------GPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIV--SYGSSSCSGIGVYTNVEH 284
                  ||    |.||.||||...         .:|.| .::|::  ..|.:..:..|::..|.:
Mouse   664 AEKIGSGP----CEGDYGGPLICE---------QHKMR-MVLGVIVPGRGCAIPNRPGIFVRVAY 714

  Fly   285 YMDWIVRTI 293
            |..||.:.|
Mouse   715 YAKWIHKVI 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 64/252 (25%)
Tryp_SPc 57..292 CDD:238113 65/254 (26%)
HgfNP_001276387.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473 64/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.