DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33225 and CLIPC9

DIOPT Version :9

Sequence 1:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_318110.3 Gene:CLIPC9 / 1278509 VectorBaseID:AGAP004719 Length:362 Species:Anopheles gambiae


Alignment Length:256 Identity:65/256 - (25%)
Similarity:91/256 - (35%) Gaps:80/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CSGSLITRLFVLTSASCLLSLPKQVILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKK- 145
            ||.::|:..|:||:|.|            ...|.....|....|   .||:        .|||| 
Mosquito   139 CSANIISERFLLTAAHC------------NPVNIAGLGCAESMQ---CDQQ--------NTVKKM 180

  Fly   146 ----------------------YDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGT 188
                                  :||||:.|.:.:..:..|.|||..:.:......:.....|||.
Mosquito   181 WPIFFFLQSFISNPKYKTSFKYHDIALVELEQNIRFNKRVLPICPYISKTDLHESEDLVIAGWGH 245

  Fly   189 TEWNEPSTILQTVTLSKINRKYCKG------------RLRQNIDASQLCVGGPRK-------DTC 234
            .:    |..|...|:..:.:..||.            :|.|.|.....|..|...       |.|
Mosquito   246 FQ----SPRLMFATVRTVLQNDCKDHYASLLKASPNKKLHQGITDEMYCAQGALVDNVTEYIDAC 306

  Fly   235 SGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYG-SSSCSGIGVYTNVEHYMDWIVRTIN 294
            |||:||||..        |.||  ..:|||::|.| ....|..|:||.|..|..||..|::
Mosquito   307 SGDSGGPLQT--------KQNN--NLYLIGVISTGFGCGSSSPGLYTRVASYFGWIKETVS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 62/249 (25%)
Tryp_SPc 57..292 CDD:238113 64/252 (25%)
CLIPC9XP_318110.3 Tryp_SPc 109..355 CDD:238113 64/252 (25%)
Tryp_SPc 109..352 CDD:214473 62/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.