DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dscama

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_068079922.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2037 Species:Danio rerio


Alignment Length:208 Identity:53/208 - (25%)
Similarity:83/208 - (39%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VGQTGF--LHCRVERLGDKDVSWI----------RKRDLHILTAGGTTYTSDQRFQVLRPDGSAN 119
            ||...|  |.|.|:......::|.          |.|.:|.:||.|...:               
Zfish   431 VGPNDFVSLTCHVKGTPQPAITWTLDDEVVAKDSRHRIVHSITAEGNVVS--------------- 480

  Fly   120 WTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNV-VELKAEIFGPSDLMVKTGSDINLTCKIMQG 183
             .|.|.:.|.||||||.|..|.... ::||...: |...|:|....:|....|.|:.:.|.::..
Zfish   481 -YLNISHIQVRDSGVYRCTCNNSAG-TVSYQARINVRGSADIRPMKNLTAIAGWDMYIHCHVIGY 543

  Fly   184 PHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC----V 244
            |:.  :|.|:|.|.:|....         |.|..::  :|....|.:::.:  |.|.|:|    .
Zfish   544 PYY--SIKWFKNSNLLPFND---------RQRAFEN--NGTLKLLNVQKEL--DEGEYSCHVQVQ 593

  Fly   245 PTVAKTSSVYVHV 257
            |.:.|..||:|.|
Zfish   594 PQLFKNQSVHVTV 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 22/82 (27%)
Ig strand A' 63..65 CDD:409355
Ig strand B 69..77 CDD:409355 3/9 (33%)
CDR1 77..83 CDD:409355 1/5 (20%)
Ig strand C 84..90 CDD:409355 1/15 (7%)
CDR2 93..109 CDD:409355 4/15 (27%)
Ig strand D 109..114 CDD:409355 0/4 (0%)
FR3 110..147 CDD:409355 11/36 (31%)
Ig strand E 119..125 CDD:409355 1/5 (20%)
Ig strand F 133..148 CDD:409355 5/14 (36%)
CDR3 148..160 CDD:409355 4/12 (33%)
IG_like 163..257 CDD:214653 23/97 (24%)
Ig strand B 174..178 CDD:409355 0/3 (0%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 1/3 (33%)
Ig strand F 240..244 CDD:409355 2/7 (29%)
dscamaXP_068079922.1 Ig 38..133 CDD:472250
Ig strand B 54..58 CDD:409353
Ig strand C 67..71 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 111..116 CDD:409353
Ig strand G 124..128 CDD:409353
Ig 137..212 CDD:472250
Ig strand B 153..157 CDD:409353
Ig strand C 169..173 CDD:409353
Ig strand E 191..195 CDD:409353
Ig strand F 205..211 CDD:409353
I-set 248..323 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 290..293 CDD:409353
Ig strand F 303..308 CDD:409353
Ig 326..408 CDD:472250
Ig strand B 344..348 CDD:409353
Ig strand C 357..361 CDD:409353
Ig strand E 381..385 CDD:409353
Ig strand F 395..400 CDD:409353
Ig 419..514 CDD:472250 26/99 (26%)
Ig strand B 437..441 CDD:409353 1/3 (33%)
Ig strand C 450..454 CDD:409353 0/3 (0%)
Ig strand E 480..484 CDD:409353 1/19 (5%)
Ig strand F 494..499 CDD:409353 3/4 (75%)
Ig strand G 507..510 CDD:409353 2/2 (100%)
IgI_5_Dscam 520..606 CDD:409550 24/100 (24%)
Ig strand A' 525..529 CDD:409550 1/3 (33%)
Ig strand B 532..539 CDD:409550 1/6 (17%)
Ig strand C 546..552 CDD:409550 2/7 (29%)
Ig strand C' 553..555 CDD:409550 0/1 (0%)
Ig strand D 562..566 CDD:409550 2/3 (67%)
Ig strand E 570..576 CDD:409550 1/5 (20%)
Ig strand F 584..592 CDD:409550 3/7 (43%)
Ig strand G 596..606 CDD:409550 4/9 (44%)
Ig 609..699 CDD:472250
Ig strand B 626..630 CDD:409353
Ig strand C 640..644 CDD:409353
Ig strand E 665..669 CDD:409353
Ig strand F 679..684 CDD:409353
Ig strand G 692..695 CDD:409353
Ig_DSCAM 702..799 CDD:409397
putative Ig strand A 702..706 CDD:409397
putative Ig strand A' 711..715 CDD:409397
putative Ig strand B 717..727 CDD:409397
putative Ig strand C 733..739 CDD:409397
putative Ig strand C' 746..749 CDD:409397
putative Ig strand D 759..762 CDD:409397
putative Ig strand E 764..770 CDD:409397
putative Ig strand F 777..785 CDD:409397
putative Ig strand G 790..799 CDD:409397
Ig_DSCAM 800..905 CDD:409398
putative Ig strand A 800..803 CDD:409398
putative Ig strand A' 811..815 CDD:409398
putative Ig strand B 818..825 CDD:409398
putative Ig strand C 833..839 CDD:409398
putative Ig strand C' 854..857 CDD:409398
putative Ig strand D 863..867 CDD:409398
putative Ig strand E 869..875 CDD:409398
putative Ig strand F 882..890 CDD:409398
putative Ig strand G 893..903 CDD:409398
FN3 906..1000 CDD:238020
FN3 <956..>1251 CDD:442628
fn3 1211..1294 CDD:394996
Ig 1324..1387 CDD:409353
Ig strand B 1324..1328 CDD:409353
Ig strand C 1337..1341 CDD:409353
Ig strand E 1362..1366 CDD:409353
Ig strand F 1376..1381 CDD:409353
fn3 1417..1483 CDD:394996
FN3 1504..1575 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.