DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and NTM

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:232 Identity:52/232 - (22%)
Similarity:91/232 - (39%) Gaps:46/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGWLL---LLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRV 77
            |.|.:   |.::.|.:|.        |..|.....|..:         .|:||..|::..|.|.:
Human    12 ISWAIFTGLAALCLFQGV--------PVRSGDATFPKAM---------DNVTVRQGESATLRCTI 59

  Fly    78 ERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTE 142
            :....: |:|:.:..  ||.||...:..|.|. ||..:....::::|:.....|.|.|.|.:.|:
Human    60 DNRVTR-VAWLNRST--ILYAGNDKWCLDPRV-VLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTD 120

  Fly   143 PKMSLSYTFNVVELKAEIFG-PSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENE 206
            .....|....:|::..:|.. .||:.:..|::|:||| |..|..| ..:.|            ..
Human   121 NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTC-IATGRPE-PTVTW------------RH 171

  Fly   207 IDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC 243
            |.........||::       |:|:......:|:|.|
Human   172 ISPKAVGFVSEDEY-------LEIQGITREQSGDYEC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 20/84 (24%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 2/7 (29%)
CDR1 77..83 CDD:409355 0/5 (0%)
Ig strand C 84..90 CDD:409355 2/5 (40%)
CDR2 93..109 CDD:409355 5/15 (33%)
Ig strand D 109..114 CDD:409355 2/4 (50%)
FR3 110..147 CDD:409355 8/36 (22%)
Ig strand E 119..125 CDD:409355 0/5 (0%)
Ig strand F 133..148 CDD:409355 4/14 (29%)
CDR3 148..160 CDD:409355 2/11 (18%)
IG_like 163..257 CDD:214653 19/81 (23%)
Ig strand B 174..178 CDD:409355 2/3 (67%)
Ig strand C 189..193 CDD:409355 0/3 (0%)
Ig strand E 226..230 CDD:409355 1/3 (33%)
Ig strand F 240..244 CDD:409355 2/4 (50%)
NTMNP_001338930.1 Ig 44..132 CDD:472250 23/91 (25%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/4 (25%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 136..205 CDD:464046 20/87 (23%)
Ig 223..307 CDD:472250
Ig strand B 239..243 CDD:409353
Ig strand C 252..256 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.