DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dscamb

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_009289749.1 Gene:dscamb / 386937 ZFINID:ZDB-GENE-031118-67 Length:2020 Species:Danio rerio


Alignment Length:327 Identity:66/327 - (20%)
Similarity:106/327 - (32%) Gaps:125/327 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRD-----LHILTAG---------------GTTY- 103
            ||.:..:||....|.|.|....:.|::|.|..:     :::...|               |..| 
Zfish   320 PRKVRGSVGSQVSLFCSVTGSDEFDITWYRNAEKIYQGINVRITGINNENLVMEGMAKSDGGAYQ 384

  Fly   104 --------TSDQRFQVLRPDG-------------------------------SANWT-------- 121
                    ::....||:..||                               :..||        
Zfish   385 CFARNGKMSTQDLVQVVLEDGTPKILSAFSEKVVSPNEPISLVCHVKGTPLPTVTWTLDDDPVIK 449

  Fly   122 -------------------LQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPS--- 164
                               |.:.:.|..|.|||.|..|.... |:||     :.:..:.||:   
Zfish   450 DSNHRMDRIITTEGHVLSYLNVSHTQVSDGGVYRCTCNNSAG-SVSY-----QARINV
RGPASIR 508

  Fly   165 ---DLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTS 226
               ::....|.|..:.|:|:..|:.  :|.|||.|.:|.......        ..|::.|     
Zfish   509 PMKNVTAIAGRDTYIHCRIIGYPYY--SIKWYKDSNLLPFNHRQR--------AFENNGT----- 558

  Fly   227 RLKIKRAMPGDTGNYTCVPTVAKTSSVY--VHVIIGEHPAAMQHNSSSNSNSFYCG----ICCML 285
             ||:......|.|.|||...|.....::  |||.: :.|..:||   |:|.|...|    |.|::
Zfish   559 -LKLSNVQNSDEGEYTCYVLVDPEKQIHRSVHVTV-KVPPLIQH---SDSQSASIGQRVFIPCVV 618

  Fly   286 LS 287
            :|
Zfish   619 IS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 25/164 (15%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 2/7 (29%)
CDR1 77..83 CDD:409355 1/5 (20%)
Ig strand C 84..90 CDD:409355 2/5 (40%)
CDR2 93..109 CDD:409355 3/39 (8%)
Ig strand D 109..114 CDD:409355 2/4 (50%)
FR3 110..147 CDD:409355 14/94 (15%)
Ig strand E 119..125 CDD:409355 3/32 (9%)
Ig strand F 133..148 CDD:409355 6/14 (43%)
CDR3 148..160 CDD:409355 2/11 (18%)
IG_like 163..257 CDD:214653 23/101 (23%)
Ig strand B 174..178 CDD:409355 0/3 (0%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 1/3 (33%)
Ig strand F 240..244 CDD:409355 2/3 (67%)
dscambXP_009289749.1 Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 112..116 CDD:409353
Ig 125..217 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 194..199 CDD:409353
Ig strand G 209..213 CDD:409353
Ig 225..310 CDD:472250
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand E 276..280 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..389 CDD:472250 13/68 (19%)
Ig strand B 331..335 CDD:409353 1/3 (33%)
Ig strand C 344..348 CDD:409353 1/3 (33%)
Ig strand E 368..372 CDD:409353 0/3 (0%)
Ig strand F 382..387 CDD:409353 1/4 (25%)
Ig 406..501 CDD:472250 13/100 (13%)
Ig strand B 424..428 CDD:409353 0/3 (0%)
Ig strand C 437..441 CDD:409353 0/3 (0%)
Ig strand E 467..471 CDD:409353 1/3 (33%)
Ig strand F 481..486 CDD:409353 3/4 (75%)
Ig strand G 494..497 CDD:409353 2/7 (29%)
Ig 504..592 CDD:472250 25/103 (24%)
Ig strand B 521..525 CDD:409353 0/3 (0%)
Ig strand C 534..538 CDD:409353 1/3 (33%)
Ig strand E 557..561 CDD:409353 2/9 (22%)
Ig strand F 571..576 CDD:409353 3/4 (75%)
Ig strand G 585..588 CDD:409353 0/2 (0%)
Ig 595..685 CDD:472250 10/29 (34%)
Ig strand B 612..616 CDD:409353 1/3 (33%)
Ig strand C 626..630 CDD:409353
Ig strand E 651..655 CDD:409353
Ig strand F 665..670 CDD:409353
Ig strand G 678..681 CDD:409353
Ig_DSCAM 688..785 CDD:409397
putative Ig strand A 688..692 CDD:409397
putative Ig strand A' 697..701 CDD:409397
putative Ig strand B 703..713 CDD:409397
putative Ig strand C 719..725 CDD:409397
putative Ig strand C' 732..735 CDD:409397
putative Ig strand D 745..748 CDD:409397
putative Ig strand E 750..756 CDD:409397
putative Ig strand F 763..771 CDD:409397
putative Ig strand G 776..785 CDD:409397
Ig_DSCAM 786..885 CDD:409398
putative Ig strand A 786..789 CDD:409398
putative Ig strand A' 797..801 CDD:409398
putative Ig strand B 804..811 CDD:409398
putative Ig strand C 819..825 CDD:409398
putative Ig strand C' 834..837 CDD:409398
putative Ig strand D 843..847 CDD:409398
putative Ig strand E 849..855 CDD:409398
putative Ig strand F 862..870 CDD:409398
putative Ig strand G 873..883 CDD:409398
FN3 887..980 CDD:238020
FN3 <938..1306 CDD:442628
Ig_3 1288..1364 CDD:464046
FN3 1398..1471 CDD:238020
FN3 1485..1557 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.