DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and wrapper

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:237 Identity:52/237 - (21%)
Similarity:87/237 - (36%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DFDVPRNLTVT-VGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSAN 119
            :..:|:.:..| :|....|.|.||......|.|........|.|..||:.|:     |:.:.|.:
  Fly   223 EVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESE-----LQTNRSVD 282

  Fly   120 -------WTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLT 177
                   ..|.:|..:..|.|.|||:.:.:    :|.....|||             ||..:...
  Fly   283 HYVNAVRHMLVVKSVRNADMGQYECRASN
Q----ISVKSGSVEL-------------TGRPMPCL 330

  Fly   178 CKIMQGPHELGN--IFWYKGS--EMLDGKGE-NEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGD 237
            .||..|.....:  :.|...|  .:::.|.: .:|.|:....:|..:||: ||            
  Fly   331 FKINPGTQSSTSHVLVWQTESLLPIMEFKLKFRQIPSNNVTRQVRTNWTE-LT------------ 382

  Fly   238 TGNYTCVPTVAKTSSVYV--HVIIGEHPAAMQHNSSSNSNSF 277
                  :|..|....:|:  :.:.|..||::...|....|||
  Fly   383 ------IPAQATNGLIYITTYTLHGLQPASLYEVSVLARNSF 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 22/89 (25%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 2/7 (29%)
CDR1 77..83 CDD:409355 2/5 (40%)
Ig strand C 84..90 CDD:409355 2/5 (40%)
CDR2 93..109 CDD:409355 5/15 (33%)
Ig strand D 109..114 CDD:409355 1/4 (25%)
FR3 110..147 CDD:409355 9/43 (21%)
Ig strand E 119..125 CDD:409355 1/12 (8%)
Ig strand F 133..148 CDD:409355 4/14 (29%)
CDR3 148..160 CDD:409355 4/11 (36%)
IG_like 163..257 CDD:214653 18/100 (18%)
Ig strand B 174..178 CDD:409355 0/3 (0%)
Ig strand C 189..193 CDD:409355 0/5 (0%)
Ig strand E 226..230 CDD:409355 0/3 (0%)
Ig strand F 240..244 CDD:409355 0/3 (0%)
wrapperNP_477404.1 IG_like 41..118 CDD:214653
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 133..219 CDD:472250
Ig strand B 150..154 CDD:409353
Ig strand C 163..167 CDD:409353
Ig strand E 183..187 CDD:409353
Ig strand F 197..202 CDD:409353
Ig strand G 211..214 CDD:409353
Ig_3 222..311 CDD:464046 23/92 (25%)
FN3 339..431 CDD:238020 20/99 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.