| Sequence 1: | NP_995908.2 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_723441.2 | Gene: | DIP-zeta / 34231 | FlyBaseID: | FBgn0051708 | Length: | 532 | Species: | Drosophila melanogaster |
| Alignment Length: | 267 | Identity: | 67/267 - (25%) |
|---|---|---|---|
| Similarity: | 103/267 - (38%) | Gaps: | 52/267 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 35 APTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAG 99
Fly 100 GTTYTSDQRFQVL--RPDGSANWTLQIKYPQPRDSGVYECQINT-EPKMSLSYTFNVVELKA-EI 160
Fly 161 FGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLT 225
Fly 226 SRLKIKRAMPGDTGNYTCV------PTVAKTSSVYV---------HVIIG--------------E 261
Fly 262 HPAAMQH 268 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_995908.2 | Ig | 53..138 | CDD:472250 | 25/86 (29%) |
| Ig strand A' | 63..65 | CDD:409355 | 0/1 (0%) | ||
| Ig strand B | 69..77 | CDD:409355 | 2/7 (29%) | ||
| CDR1 | 77..83 | CDD:409355 | 3/5 (60%) | ||
| Ig strand C | 84..90 | CDD:409355 | 2/5 (40%) | ||
| CDR2 | 93..109 | CDD:409355 | 4/15 (27%) | ||
| Ig strand D | 109..114 | CDD:409355 | 1/6 (17%) | ||
| FR3 | 110..147 | CDD:409355 | 14/39 (36%) | ||
| Ig strand E | 119..125 | CDD:409355 | 2/5 (40%) | ||
| Ig strand F | 133..148 | CDD:409355 | 8/15 (53%) | ||
| CDR3 | 148..160 | CDD:409355 | 3/12 (25%) | ||
| IG_like | 163..257 | CDD:214653 | 27/108 (25%) | ||
| Ig strand B | 174..178 | CDD:409355 | 2/3 (67%) | ||
| Ig strand C | 189..193 | CDD:409355 | 1/3 (33%) | ||
| Ig strand E | 226..230 | CDD:409355 | 1/3 (33%) | ||
| Ig strand F | 240..244 | CDD:409355 | 1/3 (33%) | ||
| DIP-zeta | NP_723441.2 | IG_like | 120..216 | CDD:214653 | 31/100 (31%) |
| Ig strand B | 130..134 | CDD:409405 | 1/3 (33%) | ||
| Ig strand C | 143..147 | CDD:409405 | 1/3 (33%) | ||
| Ig strand E | 178..185 | CDD:409405 | 2/6 (33%) | ||
| IgI_1_MuSK | 218..310 | CDD:409562 | 26/105 (25%) | ||
| Ig strand A | 218..221 | CDD:409562 | 0/2 (0%) | ||
| Ig strand A' | 226..231 | CDD:409562 | 2/4 (50%) | ||
| Ig strand B | 237..244 | CDD:409562 | 3/6 (50%) | ||
| Ig strand C | 250..255 | CDD:409562 | 2/15 (13%) | ||
| Ig strand C' | 257..259 | CDD:409562 | 0/1 (0%) | ||
| Ig strand D | 267..270 | CDD:409562 | 0/2 (0%) | ||
| Ig strand E | 275..281 | CDD:409562 | 3/7 (43%) | ||
| Ig strand F | 288..295 | CDD:409562 | 3/6 (50%) | ||
| Ig strand G | 302..310 | CDD:409562 | 3/7 (43%) | ||
| IG_like | 325..410 | CDD:214653 | 2/22 (9%) | ||
| Ig strand B | 331..335 | CDD:143207 | 0/3 (0%) | ||
| Ig strand C | 344..348 | CDD:143207 | 0/3 (0%) | ||
| Ig strand E | 376..380 | CDD:143207 | |||
| Ig strand F | 390..395 | CDD:143207 | |||
| Ig strand G | 403..406 | CDD:143207 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||