DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-zeta

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:267 Identity:67/267 - (25%)
Similarity:103/267 - (38%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 APTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAG 99
            |..|.:.....:.......|.:     |:||..|:...|.|.|:.||...|:|:......|||..
  Fly    99 ANVPTSNLNIVVEEPEFTEYIE-----NVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVH 158

  Fly   100 GTTYTSDQRFQVL--RPDGSANWTLQIKYPQPRDSGVYECQINT-EPKMSLSYTFNVVELKA-EI 160
            ....|.:.|..|.  :.|....|.|.|......|.|.|.||||| ..|....|...||.... :.
  Fly   159 NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDS 223

  Fly   161 FGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLT 225
            ...||::|:.|::|:|.|:....|..:  |.|         |.::....::.:..:.::| :|.|
  Fly   224 LSSSDVIVREGANISLRCRASGSPRPI--IKW---------KRDDNSRIAINKNHIVNEW-EGDT 276

  Fly   226 SRLKIKRAMPGDTGNYTCV------PTVAKTSSVYV---------HVIIG--------------E 261
              |:|.|....|.|.|.|:      |||:|...|.|         |.::|              .
  Fly   277 --LEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEA 339

  Fly   262 HPAAMQH 268
            ||.::.:
  Fly   340 HPTSLNY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 25/86 (29%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 2/7 (29%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 2/5 (40%)
CDR2 93..109 CDD:409355 4/15 (27%)
Ig strand D 109..114 CDD:409355 1/6 (17%)
FR3 110..147 CDD:409355 14/39 (36%)
Ig strand E 119..125 CDD:409355 2/5 (40%)
Ig strand F 133..148 CDD:409355 8/15 (53%)
CDR3 148..160 CDD:409355 3/12 (25%)
IG_like 163..257 CDD:214653 27/108 (25%)
Ig strand B 174..178 CDD:409355 2/3 (67%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 1/3 (33%)
Ig strand F 240..244 CDD:409355 1/3 (33%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 31/100 (31%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 2/6 (33%)
IgI_1_MuSK 218..310 CDD:409562 26/105 (25%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 2/4 (50%)
Ig strand B 237..244 CDD:409562 3/6 (50%)
Ig strand C 250..255 CDD:409562 2/15 (13%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 3/7 (43%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 3/7 (43%)
IG_like 325..410 CDD:214653 2/22 (9%)
Ig strand B 331..335 CDD:143207 0/3 (0%)
Ig strand C 344..348 CDD:143207 0/3 (0%)
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.