DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and LOC1277377

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_061499346.1 Gene:LOC1277377 / 1277377 VectorBaseID:AGAMI1_010886 Length:518 Species:Anopheles gambiae


Alignment Length:302 Identity:81/302 - (26%)
Similarity:109/302 - (36%) Gaps:84/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RGYNAALAPTPPTTSTT----TISPSNL-LP--------------------------YF------ 55
            ||.......|..||:||    |:.||.| ||                          |.      
Mosquito    44 RGSAMKRTKTAATTTTTRSEGTVVPSILELPPTDSCSHTSFNYKFYRYQYLRPVAILYIALAVIL 108

  Fly    56 --------DFDVP-RNLTVTVGQTGFLHCRVERLGDKDVS---------WIRKRDLHILTAGGTT 102
                    ||..| .|:||..|:.....|.|..||...||         ||:.....||......
Mosquito   109 ANVSAFEPDFVYPLENVTVAKGRDATFTCVVNNLGGYRVSGEATPARVAWIKADAKAILAIHEHV 173

  Fly   103 YTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF---GPS 164
            .|::.|..|...|.: .|||.|:..:..|.|||.||:||:| |.:...|..|.:..:|.   ...
Mosquito   174 ITNNGRLSVTHNDYN-TWTLVIRNVKMEDRGVYMCQVNTDP-MKMQTAFLEVVIPPDIIYEETSG 236

  Fly   165 DLMVKTGSDINLTCKIMQGPHELGNIFWYK--GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSR 227
            |:||..|....|.||....|..  .|.|.:  |.|::   ..|.....|....||.:    :.|.
Mosquito   237 DMMVPEGGSAKLICKARGYPKP--KIVWRREDGREII---ARNGTHGKMKATIVEGE----MLSL 292

  Fly   228 LKIKRAMPGDTGNYTCV------PTVAKTSSVYVHVIIGEHP 263
            .|:.|:   :.|.|.|:      |:|:|...:.||.    ||
Mosquito   293 TKVTRS---EMGAYMCIASNGVPPSVSKRLKLQVHF----HP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 31/134 (23%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 1/7 (14%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 4/14 (29%)
CDR2 93..109 CDD:409355 3/15 (20%)
Ig strand D 109..114 CDD:409355 1/4 (25%)
FR3 110..147 CDD:409355 16/36 (44%)
Ig strand E 119..125 CDD:409355 3/5 (60%)
Ig strand F 133..148 CDD:409355 9/14 (64%)
CDR3 148..160 CDD:409355 2/11 (18%)
IG_like 163..257 CDD:214653 26/101 (26%)
Ig strand B 174..178 CDD:409355 1/3 (33%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 1/3 (33%)
Ig strand F 240..244 CDD:409355 1/3 (33%)
LOC1277377XP_061499346.1 None

Return to query results.
Submit another query.