DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Tmprss2

DIOPT Version :10

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:43 Identity:13/43 - (30%)
Similarity:19/43 - (44%) Gaps:11/43 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   779 PALDYYL-----NHPIRKYIILKDLPD------AVRVQLLARR 810
            ||:..:|     ...:.|..|::||.|      |..||:|..|
Mouse    14 PAMKQFLLYLDETSALGKKFIIQDLDDTHVFILAEVVQILQER 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:464747
Tryp_SPc 254..485 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.