DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Ser7

DIOPT Version :10

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:278 Identity:87/278 - (31%)
Similarity:124/278 - (44%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHL-----QFLCGGSLITSEFVLTAAHCVMPTPKN 86
            |.||. .|..|:.||.:.||...||...|....     .:.||.|.|...::||||||:....:|
  Fly   122 PYCGS-AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRN 185

  Fly    87 LTVR-LGEYDWTRQMD-----SINPKHR----HREYMVTRIYTHPSYRSI-AAYDIALLKLNQTV 140
            ||.. |||  |.|..|     .:|....    |....:.||..|..|..: ...|||||:|::.|
  Fly   186 LTAAILGE--WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPV 248

  Fly   141 EYTVA--IRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDR 203
            .:...  :.|:||. |:.......|..|..|  ::|||.|::...|::.|.|.|....:..|.:.
  Fly   249 NWLQMQNLEPVCLP-PQRGRYANQLAGSAAD--VSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA 310

  Fly   204 YGHSVDHT----HICAGSSKSF-ACVGDSGSPLAMK--VVHNRRYIHAQVGIVSRGPKNCDGVTV 261
            :......|    .:|||..... :|.||||.||.::  .....||::. .|:||.|.|:| |..:
  Fly   311 FYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYL-AGVVSIGRKHC-GTAL 373

  Fly   262 F----TNVVSFTEWIFRT 275
            |    |.|.|:.:||..|
  Fly   374 FSGIYTRVSSYMDWIEST 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 80/263 (30%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 133..391 CDD:238113 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.