DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and prss56

DIOPT Version :8

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_017207703.2 Gene:prss56 / 563528 ZFINID:ZDB-GENE-070912-579 Length:849 Species:Danio rerio

Alignment Length:256 Identity:76/257 (30%)
Similarity:125/257 (49%) Gaps:47/257 (18%)


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCF---RDKNAKVLVRLGENDASQ 98
            ||.||..:||...|||..|.::...:|||.|::..:||||||||   |.::....| :||.|.: 
Zfish   190 RIIGGSPAPLGSWPWLVNLRLDGALMCGGVLVDSSWVLTAAHCFAGSRSESYWTAV-VGEFDLT- 252

  Fly    99 KIDCNESECAAPHLEYMIMQKLI-HPLYRTAHY-YDIALAKLNRYVVYTDSIRPICLM--LNPNW 159
            |.|.:|        :.|.:.::| ||.:....: .||||.:|:..|:.::.:.|:||.  |:|  
Zfish   253 KTDADE--------QIMKVNRIITHPKFNPKTFNNDIALVELSSPVILSERVTPVCLPSDLDP-- 307

  Fly   160 QVYVDTIRYFIITGWGATNASEVS-DKLQLTRIPQIDRFTCRYWFG-YMVDRTHICAGESKHYVG 222
                ......::.|||:......| |.:...::|.:.:.||:...| .::..|..|||    |:.
Zfish   308 ----PAGTPCLVAGWGSLYEDGPSADVVMEAKVPLLSQATCQSALGKELLTNTMFCAG----YLS 364

  Fly   223 ------KGDSGGPLGSMVDYKYAKRFFQFGIVS------HLRQPFHGVSVFTNILSYSNWI 271
                  :|||||||  :...:.:.||...||.|      ...:|    .|:|.:.::|:|:
Zfish   365 GGIDSCQGDSGGPL--IFQDRLSGRFQLLGITSWGDGCGEKGKP----GVYTRVTAFSDWV 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 76/255 (30%)
Tryp_SPc 38..274 CDD:238113 75/256 (29%)
prss56XP_017207703.2 Tryp_SPc 191..419 CDD:238113 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C328745896
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.