DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG9672

DIOPT Version :8

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster

Alignment Length:269 Identity:61/270 (23%)
Similarity:101/270 (37%) Gaps:71/270 (26%)


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKN-----AKVL--VRLGEN 94
            ||.||.|:.|...|:.|.|.|...:.||..::...:.|||..|.....     |.||  |.:|  
  Fly    24 RIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCSDGKDTPWAAVLFAVTVG-- 86

  Fly    95 DASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLN-PN 158
                .:|....:      :..:.:..|:|.|.|.. ..|||.:|...:.:::::..|.|..: |.
  Fly    87 ----SVDLYNGK------QIRVEEITINPNYSTLK-TGIALLRLQEEITFSETVNAIPLSQDVPP 140

  Fly   159 WQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQI----------------DRFTCRYWFGYMV 207
            ....|:      ::|||.|..|||:    :.|..||                |..       .:.
  Fly   141 MGSQVE------VSGWGRTTESEVN----MHRTLQIGAAEVMAPRECALANRDEL-------LVA 188

  Fly   208 DRTHICAGESKHY-VGKGDSGGPL---GSMVDYKYAKRFFQFGIVSHLRQPFHGV--SVFTNILS 266
            |...:|.|..:.. :..||.|||.   |.:|           |:.:.:.....|:  ..|.:|.:
  Fly   189 DDQVLCLGHGRRQGICSGDIGGPAVYQGQLV-----------GLGAQILGECGGMLPERFISIAA 242

  Fly   267 YSNWIHRTI 275
            ..:||.:.:
  Fly   243 NYDWIQQQL 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 60/264 (23%)
Tryp_SPc 38..274 CDD:238113 60/266 (23%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 60/264 (23%)
Tryp_SPc 25..250 CDD:238113 60/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24278
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.