DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and F10

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:258 Identity:73/258 - (28%)
Similarity:127/258 - (49%) Gaps:33/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKF--ICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQK 99
            ||.||::......||.|.|..:.:.  .|||::||.:::||||||..... :..||:|:.:..|:
  Rat   231 RIVGGQECKRGECPWQALLFSDEETDGFCGGTILNEFYILTAAHCLHQAK-RFKVRVGDLNTEQE 294

  Fly   100 IDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNW-QVYV 163
             |..|    ..|...||::.  :...|..:.:|||:.:|...:.:.:::.|.||. ..:| :..:
  Rat   295 -DGGE----MVHEVDMIIKH--NKFQRDTYDFDIAMLRLKTPITFRENVAPACLP-QKDWAEATL 351

  Fly   164 DTIRYFIITGWGATNASEVSDK-LQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGK---- 223
            .|.:..|::|:|.|:......| |::..:|.:||.|||....:.:.:...|||    |..|    
  Rat   352 MTQKTGIVSGFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTSFSITQNMFCAG----YDAKQEDA 412

  Fly   224 --GDSGGPLGSMVDYKYAKRFFQFGIVSH----LRQPFHGVSVFTNILSYSNWIHRTIITNSG 280
              ||||||..:    ::...:|..||||.    .|:..:|  ::|.:.::..||.|::....|
  Rat   413 CQGDSGGPHVT----RFKDTYFVTGIVSWGEGCARKGKYG--IYTKVTAFLKWIDRSMKARVG 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 69/247 (28%)
Tryp_SPc 38..274 CDD:238113 70/249 (28%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 70/248 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.