DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG30090

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:281 Identity:104/281 - (37%)
Similarity:156/281 - (55%) Gaps:7/281 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALLALLILGHGI--SLGYSYLLEWDCGISKYT--YRITGGRDSPLMLNPWLAYLHINSKFICGGS 66
            |:.|:..|..|:  |||....||..||::..|  ::|.||||:.:..|||:||:|.:.|.||||:
  Fly     4 AIAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGT 68

  Fly    67 LLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLY-RTAHY 130
            |:...||||||||..:.:| |.|||||.|.:...|||...|.....|:.:.....|..: ...:.
  Fly    69 LITQRFVLTAAHCVNEGSA-VKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNL 132

  Fly   131 YDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQID 195
            .||||.:|.::|.:...|.|||::|..:.:..||:|.:|:.||||.|........||:|::.:.:
  Fly   133 NDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYN 197

  Fly   196 RFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSV 260
            ...|....|.:|.:..||||........|||||||...|.:....|..|||:||:..:...|:.|
  Fly   198 SSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV 262

  Fly   261 FTNILSYSNWIHRTIITNSGH 281
            :|::.||::|| .|::..:.|
  Fly   263 YTDVYSYADWI-ATVVQQNTH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 88/234 (38%)
Tryp_SPc 38..274 CDD:238113 90/236 (38%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 88/234 (38%)
Tryp_SPc 40..276 CDD:238113 90/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.