DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33337 and oac-10

DIOPT Version :8

Sequence 1:NP_996269.2 Gene:CG33337 / 2768678 FlyBaseID:FBgn0053337 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_494678.3 Gene:oac-10 / 183607 WormBaseID:WBGene00016773 Length:670 Species:Caenorhabditis elegans

Alignment Length:437 Identity:91/438 (21%)
Similarity:147/438 (34%) Gaps:155/438 (35%)


  Fly   269 LHGIRCMSLFWVVWIHQYDNVFSAPNINRFRFLSWLQTPFTMFFLEGNFSVDSFFFIGGFLVSLN 333
            |.|:|.:::..||..|.:...|  ||                    |...||.||.:.|||::: 
 Worm     6 LQGVRGLAIGAVVAFHFFPESF--PN--------------------GYIGVDIFFVLSGFLMAM- 47

  Fly   334 ALGTMEKNNGKINVPRMYIRRFIRIFPILAMSILVYTQLTGVLGDGPLFKGGYSK---KASCAKT 395
            .:||  |.....:|.:.|.||..||.|:....:.|...|..||         :.|   ..:....
 Worm    48 IIGT--KPITCDSVYQFYFRRSKRILPLYLFIVFVGVILVFVL---------FPKTFLSMNMDSA 101

  Fly   396 WYMTLLF--------------VVNFANDMCLDHTWYLAVDMQLFLISPILLFALYKWGKKAAAAI 446
            |....|:              ::|.|.|: ..|||.|.|:||.::::|.:.|             
 Worm   102 WSSIFLYHNMAQHSDNNMYFKMLNQAEDI-FTHTWSLCVEMQFYILAPAIFF------------- 152

  Fly   447 GVLIVLLSGCLFATMMVNHYSI---KSLDFSLQKKTYFYTHTHAA-------PWLIGFLYGYFVF 501
                 :.|.|...|.:..::.|   .||.      ||.::....|       .|  .||.|..||
 Worm   153 -----VFSQCTTGTSLALYHIIFIFTSLG------TYLFSSDQIAFNSVFCRVW--QFLIGSAVF 204

  Fly   502 LNKGRKFKMNWIAVWSGWILCLAMLFTSIFAL-YPKLESGKPWLMTTLEVSSYYTLTRVGWPMAV 565
            ....:|.:.:          |      |:.:: |.||...:.......|..||  |.|....:.:
 Worm   205 FYSQKKCEQS----------C------SVNSIEYSKLPENEMEEQIPQENKSY--LNRYSIVLFI 251

  Fly   566 GWVVFACM-------------------------QGYGGMANTFLSSPLWQPISKLSYSIYI--WH 603
            ..:...||                         .|.....|...:..|.. :..:|||:|:  |.
 Worm   252 ALLTIVCMVFSPWPFPGDILRVTSTIVTGVLILSGAQSDKNPLRTGALVY-LGDVSYSLYLIHWP 315

  Fly   604 SFIQEINKRIVRTNTYFSNY---QVMLNFWSTMGFTVLFSYLLYLLI 647
            .|:            |..:|   |.::.|     ..::||.||.:::
 Worm   316 VFV------------YVKHYYGEQFLVYF-----LAIIFSTLLAIIM 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33337NP_996269.2 NRF 85..196 CDD:214781
Acyl_transf_3 266..645 CDD:280013 91/434 (21%)
OafA 300..666 CDD:224748 82/407 (20%)
oac-10NP_494678.3 OafA 1..366 CDD:224748 91/438 (21%)
Acyl_transf_3 3..346 CDD:280013 91/438 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000086
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.