DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p53 and tp53

DIOPT Version :9

Sequence 1:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001001903.1 Gene:tp53 / 431679 XenbaseID:XB-GENE-484286 Length:362 Species:Xenopus tropicalis


Alignment Length:321 Identity:78/321 - (24%)
Similarity:132/321 - (41%) Gaps:59/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 NLMQFSQQSVLREMMLQDIQIQANTLPKLENHNI-------GGYCFSMVLDE--PPKSL-WMYSI 219
            |..:||:..:..:|.:....:..||:|.:.:..:       |.|...:...:  ..||: ..||.
 Frog    38 NFAEFSEYPLAPDMTVLQEGLMGNTVPTVTSSAVPSTEDYAGSYGLKLEFQQNGTAKSVTCTYST 102

  Fly   220 PLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCF--SNDVSAPVVRCQNH-LSVEPLTANNAK 281
            .||||:.::.|...:.|:.:...|:..: ||....:  |..|:..|.||.:| .||||  .::..
 Frog   103 DLNKLFCQLAKTCPLLVRVERPPPLGSI-LRATAVYKKSEHVAEVVKRCPHHERSVEP--GDDPA 164

  Fly   282 MRESLLRSENPNSVYCGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIG--- 343
            ....|:|.|..:..|.....|.|   |.||.||.    ...:.|....|:.:.::|.:||:|   
 Frog   165 PPSHLMRVEGNSKAYYMEDVGTG---RHSVCVPY----EGPQVGTECTTVLYNYMCNSSCMGGMN 222

  Fly   344 RKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDERQLNSKKRKSVPEAAEE-------DE 401
            |:....:..||...|.::|:....|::|.||.|||..:|... :|||...|....|       |.
 Frog   223 RRPILTIITLESPEGLLLGRRCFEVRVCACPGRDRRTEEDNC-TKKRGLKPNGKRELSHPPSSDP 286

  Fly   402 PSKVRRCIAIKTEDT---------------ESNDSRDCDDSAAEWNVSRTPDGDYRLAITC 447
            |...:|.:....|:|               :.||:.:..:|..:          .:|:|.|
 Frog   287 PLPKKRLVEEDDEETFTLLIKGRSRYEMIKKLNDALELQESLDQ----------QKLSIKC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p53NP_996267.1 P53 203..383 CDD:176262 52/188 (28%)
P53_C 429..495 CDD:288471 3/19 (16%)
tp53NP_001001903.1 P53_TAD 5..29 CDD:369955
P53 84..264 CDD:176262 53/189 (28%)
P53_tetramer 296..329 CDD:369476 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9868
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002925
OrthoInspector 1 1.000 - - otm48487
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6184
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.