DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pxd and cd

Sequence 1:NP_001163633.1 Gene:Pxd FlyBaseID:FBgn0004577 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:711 Identity:219/712 (31%)
Similarity:318/712 (45%) Gaps:100/712 (14%)


  Fly    11 ALLGFISSA----LGLKVSSGYHIVHN--QPQS----SFPNYHGFS------------YLQGSAP 53
            |.||....|    .|:|......|:..  ||..    ||.:|...|            |::..|.
  Fly   112 AALGHHDGAQAVSAGIKALGDREILEEGLQPNEVNTPSFRHYRSLSTNPEARKLARRGYVENQAT 176

  Fly    54 YVIGNSLPTSPAPQNPFSSPASPPVSAYGYS------FPTAGRVSCAAPPAVCEKTAYRTLDGSC 112
            ..|...          |:....|..|..|:.      .||..|:.|..      ...||...|.|
  Fly   177 IDIAKR----------FNYTKQPGRSNIGWGPKIVLPDPTVLRLECDF------NARYRRSTGVC 225

  Fly   113 NHLEQP-GLGVANSKYGRLLTPKYADGISAPTRSVTGDELPSARLVSLVAFGEQDVPDPEFTLHN 176
            |:.:.| ..|.:...|.|:::|.|||||:||..|..| .||.||.|||.........|..||:..
  Fly   226 NNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHG-RLPPARQVSLKIHRSSYETDSNFTVML 289

  Fly   177 MQWGQIMTHDMSMQAGGTQSKKHPTRCCTDDGRLIGLDTAHKTCFAIIVPPHDPAYSQVGTECLN 241
            ..:||.|.||::..:..|..:.....||....|     ..|..|:.:.:.|.||.|.|....|:|
  Fly   290 AVFGQFMDHDITATSLTTSQEGESIDCCVAATR-----EQHPECYPVDILPDDPYYKQYNISCMN 349

  Fly   242 FVRTL---TDRDSNCQYQGGPAEQLTVVTSYLDLSLVYGNSIQQNSDIREFQGG--RMIVEERNG 301
            |||:.   |.|       .||..||...|:::|.|:||||..|:.:.:|.|..|  ||.|.: :|
  Fly   350 FVRSAPAPTGR-------FGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMFVTD-DG 406

  Fly   302 AKWLPLSRNVTGDCDAVDASEV---CYRSGDVRVNQNPGLAILQTILLREHNRIADALSALNPHY 363
            .:.||:|.|....|:.|..:.:   |:.|||.|.|:|..|..:..:..|.||.:|..|...|||:
  Fly   407 RQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHW 471

  Fly   364 DDRTLFQEARKINIAQYQQISYYEWLPIFLG-----GENMLKNRLIYKAPSGSYINDFDPNIDPS 423
            :|..|:||||||..||...|:|.|:||:.||     .:.:|..:....||     :.:||.:|||
  Fly   472 EDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAP-----DTYDPEVDPS 531

  Fly   424 VLNEHATAAFRYFHSQIEGRLDL--------LSELRQVLGSLTLSDWFNRPGIIEVGDNFDSLTR 480
            :.|..|.||||:.|:.:.|..::        ..||.::|        || |..:......|....
  Fly   532 IANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIELHKML--------FN-PFSLWAEHGIDHALM 587

  Fly   481 GHATQPEELTDINFDRQIKHFLF----RRNMPF-GSDLRSLDIQRNRDHGLASYNDMREFCGLRR 540
            ..|..|....|..|..::...||    ...:|. |.||.||:|||.||||:.||...|..|.|..
  Fly   588 TAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPT 652

  Fly   541 AHSWEGYGDLISPPILEKLKSLYPSHEDVDLTVGASLEAHVAGALAGPTFLCILTEQFYRTRVGD 605
            ..:||.....|....|:.::.:|.|.:|||:..||..|..:.||:.||...|::::||.|.::||
  Fly   653 VDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGD 717

  Fly   606 RFFFENGDKLTGFTPDQLEELRKASMARLLCDNGNHISSMQPEAF-RTVSHSNPIIPCSNI 665
            ..::|.......||..||.|:.|.|:|.::|.|.:.|:.::.... |.....||.:.|.::
  Fly   718 SHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQDL 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PxdNP_001163633.1 An_peroxidase 105..643 CDD:281139 191/565 (34%)
peroxinectin_like 260..638 CDD:188655 135/401 (34%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 191/565 (34%)
peroxinectin_like 364..750 CDD:188655 135/401 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2019
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11475
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.