DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Prss46

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_898926.2 Gene:Prss46 / 74306 MGIID:1921556 Length:314 Species:Mus musculus


Alignment Length:288 Identity:66/288 - (22%)
Similarity:122/288 - (42%) Gaps:43/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 DPRSQISSVVCGREGSTTPF-----------------IVRGNEFPRGQYPWLSAVYHKEVRALAF 304
            ||...:||.:.....::.|:                 :|.|.....|::||..::....:    :
Mouse     7 DPHGLLSSPLASARLNSLPYMEGPWIWSCGQTNITCKVVNGKAVEVGKWPWQVSILFLGM----Y 67

  Fly   305 KCRGSLISSSIVISAAHCVHRMTED-RVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYS 368
            .|.||||....:::||||:.|.... :..|.:|...|.|  ...:|:. |.|::.|.::..| .|
Mouse    68 ICSGSLIHHHWILTAAHCLQRSKNPAKYTVKVGVQTLPD--NSTSELL-VTRIVIHENFINR-MS 128

  Fly   369 DADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVE---AEIA 430
            | |||::.::.|||::.::.|||:.:.....::.|..::.|||.::.....:.|..|:   ..|.
Mouse   129 D-DIAILKLKYPVTWSPLVQPICLPSFNLKPSIGTMCWVVGWGLEKAEGHPKTPYSVQGLAVRIV 192

  Fly   431 SPTVCASTWRGTMVTERS-------LCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERG 488
            :..:|...::..::..:.       ||..:..|...|...||..|:.:....|:..|:||..   
Mouse   193 NNEICNHRYQFLLLKNQKKFIGNDMLCTSSEWGLDTCQDTSGSSLVCQMNKTWVQMGVVSWN--- 254

  Fly   489 PAGTCQLNQY-VLYCDLSKHINWISENI 515
              ..|...|: .:|...|....||...|
Mouse   255 --FDCGRRQFPSVYTSTSHFTQWIKRQI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 60/248 (24%)
Tryp_SPc 277..511 CDD:214473 58/245 (24%)
Prss46NP_898926.2 Tryp_SPc 43..276 CDD:214473 58/246 (24%)
Tryp_SPc 44..279 CDD:238113 60/248 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.