DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Hgfac

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_445772.1 Gene:Hgfac / 58947 RGDID:70909 Length:653 Species:Rattus norvegicus


Alignment Length:298 Identity:86/298 - (28%)
Similarity:134/298 - (44%) Gaps:49/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPF----IVRGNEFPRGQYPWLSAVYHKEVR 300
            |..:.|:|.:|          ..:...||:......|    |:.|:....|.:|||:|:|...  
  Rat   375 PEVLATLPEST----------STARPTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGN-- 427

  Fly   301 ALAFKCRGSLISSSIVISAAHCVHRM-TEDRVVVGLGRYDLD---DYGEDGAEMRNVMRLLWHPD 361
              .| |.|||:.:..|:|||||.... ..|.:.|.||::..:   |..:..|..:.|...|    
  Rat   428 --GF-CAGSLVHTCWVVSAAHCFSSSPPRDSITVVLGQHFFNRTTDVTQTFAIEKYVPYTL---- 485

  Fly   362 YNTRSYSDADIALITI----ERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGR-DEDSS---- 417
            |:..:.:|.|:.||.:    ||....:..:.|||:....:|........|||||. ||:.|    
  Rat   486 YSVFNPNDHDLVLIRLKKKGERCAVRSQFVQPICLPEAGSSFPTGHKCQIAGWGHMDENVSGYSN 550

  Fly   418 ---RTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRD-GSGPCVGDSGGGLMVKQGDRWLL 478
               ....|.|.:.:.:||.|     .|..::...||||..| .|..|.|||||.|:.::.....|
  Rat   551 SLLEALVPLVADHKCSSPEV-----YGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYL 610

  Fly   479 RGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516
            .||:|.|:    |..:||:..:|..:|.:::||::.||
  Rat   611 YGIISWGD----GCGRLNKPGVYTRVSNYVDWINDRIR 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 77/253 (30%)
Tryp_SPc 277..511 CDD:214473 75/250 (30%)
HgfacNP_445772.1 FN2 99..145 CDD:128373
EGF_CA 159..194 CDD:238011
FN1 197..237 CDD:238018
EGF 242..274 CDD:278437
Kringle 283..364 CDD:278480
Tryp_SPc 405..639 CDD:214473 75/251 (30%)
Tryp_SPc 406..641 CDD:238113 77/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.