| Sequence 1: | NP_996209.2 | Gene: | Sp212 / 2768666 | FlyBaseID: | FBgn0053329 | Length: | 516 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001016055.2 | Gene: | LOC548809 / 548809 | -ID: | - | Length: | 334 | Species: | Xenopus tropicalis | 
| Alignment Length: | 296 | Identity: | 77/296 - (26%) | 
|---|---|---|---|
| Similarity: | 127/296 - (42%) | Gaps: | 56/296 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   243 VVTVPPATPPPQRFDPRSQISSVVCGREGSTTPF----IVRGNEFPRGQYPWLSAVYHKEVRALA 303 
  Fly   304 FKCRGSLISSSIVISAAHCVH--RMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRS 366 
  Fly   367 YSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGF-------IAGWGRDEDSSRTQYPRV 424 
  Fly   425 VEAEIASPTVCASTWRG------------TMVTERSLCAGNRDG-SGPCVGDSGGGLMVKQGDRW 476 
  Fly   477 LLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWIS 512  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Sp212 | NP_996209.2 | GD_N | 23..122 | CDD:292649 | |
| Tryp_SPc | 277..514 | CDD:238113 | 70/258 (27%) | ||
| Tryp_SPc | 277..511 | CDD:214473 | 68/255 (27%) | ||
| LOC548809 | NP_001016055.2 | Tryp_SPc | 57..294 | CDD:214473 | 68/255 (27%) | 
| Tryp_SPc | 58..297 | CDD:238113 | 70/258 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||