DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and proca

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:254 Identity:80/254 - (31%)
Similarity:130/254 - (51%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYD 339
            |:::.||...||:.||.:.:.:...|   |.|.|.||..:.|::||||:.  |..:..|.||.|.
Zfish   193 PWVMGGNVGKRGESPWQALILNHLGR---FHCGGVLIDENWVLTAAHCLE--TSSKFSVRLGDYQ 252

  Fly   340 LDDYGEDGAEMR-NVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTV-- 401
            ...:  :|:|:. .|.:.:.||.||..:. |.||||:.::.||.|:..|.|.|:.::|.::.:  
Zfish   253 RFKF--EGSEVTLPVKQHISHPQYNPITV-DNDIALLRLDGPVKFSTYILPACLPSLELAKRMLH 314

  Fly   402 --STTGFIAGWGRDEDSSRTQYP---RVVEAEIASPTVCASTWRGTMVTERSLCAG----NRDGS 457
              .|...|.|||::..|: |.|.   ..||..|.....|:......: ::..||||    .:|. 
Zfish   315 RNGTVTIITGWGKNNQSA-TSYNSTLHYVELPIVDNKECSRHMMNNL-SDNMLCAGVLGQVKDA- 376

  Fly   458 GPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516
              |.|||||.:|....|.|.|.|:||.||    |..|.::..:|..::.:::|| :::|
Zfish   377 --CEGDSGGPMMTLFHDTWFLVGLVSWGE----GCGQRDKLGIYTKVASYLDWI-DSVR 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 78/248 (31%)
Tryp_SPc 277..511 CDD:214473 76/245 (31%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342
Tryp_SPc 195..427 CDD:238113 78/249 (31%)
Tryp_SPc 197..424 CDD:214473 76/243 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.