DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Np

DIOPT Version :10

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_061514435.1 Gene:Np / 3291870 VectorBaseID:AGAMI1_007541 Length:1276 Species:Anopheles gambiae


Alignment Length:81 Identity:19/81 - (23%)
Similarity:35/81 - (43%) Gaps:15/81 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HSEVMNDTREPNRNSFHCPICRKRVSMSKVIQNYTLKNVLDSINELSREEEKSRRAYDNTLDASN 134
            :::::|.|::..: ::.|..||.|.    :|..|||:          |.....|||..|...|..
Mosquito   217 NAKLLNKTKQFIK-AYFCVACRPRC----MIWRYTLR----------RAGNSQRRAILNLPSAIV 266

  Fly   135 EQLRVKCIDLERKADS 150
            ..:....:||...:|:
Mosquito   267 STITQFLLDLTGISDA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..127 CDD:464985 14/56 (25%)
Tryp_SPc 277..514 CDD:238113
NpXP_061514435.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.