DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Tpsg1

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:281 Identity:73/281 - (25%)
Similarity:117/281 - (41%) Gaps:69/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CGR-----EGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRM 326
            ||:     .||.   ||.|:....|.:||.:::..::|..    |.|||:|...|::||||..  
  Rat    18 CGQPQVSHAGSR---IVGGHAAQAGAWPWQASLRLQKVHV----CGGSLLSPEWVLTAAHCFS-- 73

  Fly   327 TEDRVVVGLGRYDLDDY----GEDGAEMRNVMRLLWHPDYNTRS----YSDA--------DIALI 375
                     |..:..||    ||        :.:...|.::|..    ||.|        ||||:
  Rat    74 ---------GSVNSSDYEVHLGE--------LTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALV 121

  Fly   376 TIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYP--------RVVEAEIASP 432
            .:..||..:..:.|:|:....|........::.|||..::....:.|        .||:.|..|.
  Rat   122 QLATPVALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQ 186

  Fly   433 TVCASTWRGTMVTERSLCAGNRDGSGP---CVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQ 494
            ...:|  .|:::....|||.     ||   |..||||.|:.:....|...|:||.||    |..:
  Rat   187 AYSSS--NGSLIQSDMLCAW-----GPGDACQDDSGGPLVCRVAGIWQQAGVVSWGE----GCGR 240

  Fly   495 LNQYVLYCDLSKHINWISENI 515
            .::..:|..::.::|||..:|
  Rat   241 PDRPGVYARVTAYVNWIHRHI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 68/263 (26%)
Tryp_SPc 277..511 CDD:214473 66/260 (25%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 66/264 (25%)
Tryp_SPc 30..260 CDD:238113 68/263 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.