DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG30286

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:267 Identity:68/267 - (25%)
Similarity:115/267 - (43%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 GSTTPFIVRGNEFPR--GQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVV 333
            |..:|..::..|...  .:.||: |..||....:   |.|:|::...:::||||:..  ::.:.|
  Fly    27 GYMSPEALQNEEHQAHISESPWM-AYLHKSGELV---CGGTLVNHRFILTAAHCIRE--DENLTV 85

  Fly   334 GLGRYD----LDDYGED---GAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPIC 391
            .||.::    :|..|.|   .:|...:.....|..| :|:....||.|:.:.:.|.:...|.|||
  Fly    86 RLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGY-SRTNRIHDIGLLRLAKSVEYKVHIKPIC 149

  Fly   392 MWT-------VE-ASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTER- 447
            :.|       :| ..|.|:|     ||||....:.....:.:.....:..||:.|:   .|..| 
  Fly   150 LITNTTLQPKIERLHRLVAT-----GWGRSPSEAANHILKSIRVTRVNWGVCSKTY---WVDRRR 206

  Fly   448 -SLCAGNRDGSGPCVGDSGG--GLMVKQGDRWLL--RGIVSAGER---GPAGTCQLNQYVLYCDL 504
             .:|..:..|.. |.|||||  |..::...|.|.  .||||.|..   .|:         ::.::
  Fly   207 DQICVSHESGVS-CSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPS---------VFTNV 261

  Fly   505 SKHINWI 511
            .:||:||
  Fly   262 MEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 66/261 (25%)
Tryp_SPc 277..511 CDD:214473 64/259 (25%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 65/255 (25%)
Tryp_SPc 39..268 CDD:214473 63/253 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.