DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG30083

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:262 Identity:86/262 - (32%)
Similarity:128/262 - (48%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVY---HKEVRALAFKCRGSLISSSIVISAAH 321
            ||.....||.. ..:|.|:.|.....|..||::.::   .|||..|.  |.|:||....|:||||
  Fly    18 SQFLEPNCGYP-DISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELV--CGGTLIHKQFVLSAAH 79

  Fly   322 CVHRMTEDRVV-VGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFND 385
            |:.|   |::: |.||.:....|.......||..       :.|.|||: ||.::.|:..|.||.
  Fly    80 CIKR---DQILAVRLGEHSSSRYFAVTKAFRNKY-------FTTGSYSN-DIGILRIQPIVKFNA 133

  Fly   386 IIAPICMWTVEASRTVSTTGF-IAGWGRDEDSSRTQYPRVVEAEIASPTVCAS-TWRGTMVTERS 448
            :|.|||:.| :.::..:...| .||||:.|:.:.::..:.||....:.:.|.: .|  ..|||..
  Fly   134 VIRPICIIT-DPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLW--VNVTESQ 195

  Fly   449 LCAGNRDGSGPCVGDSGGGL---MVKQGD-RWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHIN 509
            :|||:.||. .|.|||||.|   :...|. |::..||:|.|    :..|  |...:|..||..|:
  Fly   196 ICAGHPDGD-TCAGDSGGPLIHPVYMDGSLRYVQLGIISFG----SSLC--NSPGVYTRLSSFID 253

  Fly   510 WI 511
            ||
  Fly   254 WI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 81/245 (33%)
Tryp_SPc 277..511 CDD:214473 79/243 (33%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 79/244 (32%)
Tryp_SPc 34..255 CDD:238113 79/243 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.