DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and AgaP_AGAP008808

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_557970.3 Gene:AgaP_AGAP008808 / 1275666 VectorBaseID:AGAP008808 Length:574 Species:Anopheles gambiae


Alignment Length:267 Identity:80/267 - (29%)
Similarity:143/267 - (53%) Gaps:23/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 VVCGREGSTTPFIV-RGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHR--- 325
            :.|||....:.|:: .|.:...|.:||.:|::|...|...::|.||::..:.:::|:|||:.   
Mosquito    31 LTCGRRKVQSVFLIHNGVDAKAGHWPWHAAIFHGNGRQEEYQCGGSILDQNTILTASHCVYTHKS 95

  Fly   326 -MTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAP 389
             ::..||.|.:|:..|.:..| ..::..|..::.||::|:.|::: ||||:.:...:|....:.|
Mosquito    96 VISAARVSVHVGQIHLKETSE-YTQIHGVQDIILHPEFNSNSFNN-DIALLKLSTNITMTKYVQP 158

  Fly   390 ICMWTVEASR--TVSTTGFIAGWGRDE-----DSSRTQYPRVVEAEIASPTVCASTWR---GTMV 444
            :|:||:::::  .|...|.|.|:|.:|     |..:.....||:|     ..|..:.|   |.::
Mosquito   159 VCLWTMDSNQEMIVGKNGTIVGFGLNEHDVVSDQLKQALVGVVDA-----LTCIKSDRAAFGPVL 218

  Fly   445 TERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVS-AGERGPAGTCQLNQYVLYCDLSKHI 508
            |....|...|.|.|.|.||||||:..:.|.:|.:||:|| ...||..|.|...:|..|.|::|::
Mosquito   219 TSEMFCGKGRTGVGACNGDSGGGMFFEVGGKWFVRGLVSFTPLRGNTGLCDPLKYTAYTDVAKYL 283

  Fly   509 NWISENI 515
            .||.:.|
Mosquito   284 EWIKQYI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 75/252 (30%)
Tryp_SPc 277..511 CDD:214473 73/249 (29%)
AgaP_AGAP008808XP_557970.3 Tryp_SPc 44..288 CDD:238113 75/250 (30%)
Tryp_SPc 46..286 CDD:214473 73/246 (30%)
Tryp_SPc 324..566 CDD:304450
Tryp_SPc 330..566 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 145 1.000 Domainoid score I9368
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D294086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9620
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X174
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.