DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and AgaP_AGAP010662

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_311382.4 Gene:AgaP_AGAP010662 / 1272470 VectorBaseID:AGAP010662 Length:584 Species:Anopheles gambiae


Alignment Length:265 Identity:81/265 - (30%)
Similarity:142/265 - (53%) Gaps:18/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CGREGSTTPFIVRGNEFPR-GQYPWLSAVYHKEVRALAFK--CRGSLISSSIVISAAHCVHRMTE 328
            ||........:|:|....: |.:||.:|:||:.:.:..|:  |.||::...:|::|||||...|.
Mosquito    29 CGERMVKRKGLVKGGYSTQPGDWPWHAALYHRGINSAGFEYACGGSIVHRYLVLTAAHCVTLATS 93

  Fly   329 DRVV------VGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDII 387
            .|.:      :.|||::|.:..|:.||..:|:..:.|..|...::.: |||::.:|.|:.|||.|
Mosquito    94 RRKIPAENMQLRLGRFNLMNNEEEYAEEFDVIETIMHEGYRPTTFEN-DIAILRVEIPIIFNDYI 157

  Fly   388 APICMWTVEASRTV----STTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWR---GTMVT 445
            .|:|:|..:....:    :..|.:.|||..||:............:.....|.::.|   |..:.
Mosquito   158 QPVCLWKRDDGVVLPWFYNQPGTVVGWGLSEDNMIGTTLNEARMPVVDSWTCLASDRAFFGKFLQ 222

  Fly   446 ERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVS-AGERGPAGTCQLNQYVLYCDLSKHIN 509
            .::.|||.::|:|.|.||||||:..:..:||.|:|:|| :.....:|.|.|.||:.:.|.|::|:
Mosquito   223 SKAFCAGYKNGTGVCNGDSGGGMFFQFQNRWYLKGVVSFSNTNDYSGVCNLKQYIGFTDASQYID 287

  Fly   510 WISEN 514
            |:.:|
Mosquito   288 WVYDN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 78/253 (31%)
Tryp_SPc 277..511 CDD:214473 77/250 (31%)
AgaP_AGAP010662XP_311382.4 Tryp_SPc 42..292 CDD:238113 77/250 (31%)
Tryp_SPc 42..289 CDD:214473 76/247 (31%)
Tryp_SPc 334..578 CDD:214473
Tryp_SPc 334..578 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 145 1.000 Domainoid score I9368
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D294086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9620
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X174
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.