DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and ort

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_524406.1 Gene:ort FlyBaseID:FBgn0003011 Length:485 Species:Drosophila melanogaster

Alignment Length:477 Identity:158/478 (33%)
Similarity:240/478 (50%) Gaps:71/478 (15%)


Human    27 CKDHDSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMD 91
            |..|.::...|  |:|:.:|.|.:.:.|   ||....|..:|.|..|..::.:....|:.|.:|.
  Fly    14 CMKHYAKGEFQ--QSLAITDILPEDIKR---YDKMRPPKKEGQPTIVYFHVTVMGLDSIDENSMT 73

Human    92 YRVNIFLRQQWNDSRLAYSEYPDDSLD----LDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLL 152
            |..::|..|.|.|.||   ..|::...    |:...|.::|:||.||.|.|...|..:|..|..:
  Fly    74 YVADVFFAQTWKDHRL---RLPENMTQEYRLLEVDWLKNMWRPDSFFKNAKSVTFQTMTIPNHYM 135

Human   153 RISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLT 217
            .:.|:..:||.::|||.|||.|:...:|.|.|.|.:|:||..:|.:||||:|....|:.|.|.:.
  Fly   136 WLYKDKTILYMVKLTLKLSCIMNFAIYPHDTQECKLQMESLSHTTDDLIFQWDPTTPLVVDENIE 200

Human   218 LPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDA 282
            |||..| ...|...||:.|:||.|||:||.|.|:|::.||:...|||:.:|||:|||||||..:|
  Fly   201 LPQVAL-IRNETADCTQVYSTGNFTCLEVVFTLKRRLVYYVFNTYIPTCMIVIMSWVSFWIKPEA 264

Human   283 APARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFV------ 341
            |||||.||:|::||::||.:.|::|||.|||:||:|.:|:||.:|||.||:||..:|.|      
  Fly   265 APARVTLGVTSLLTLSTQHAKSQSSLPPVSYLKAVDAFMSVCTVFVFMALMEYCLINIVLSDTPI 329

Human   342 --------------------------------SRQHKEFLRL--RRRQKRQNKEEDVTRESRFNF 372
                                            |:|....|.|  .:.:|.:...:::|:..|...
  Fly   330 PKPMAYPPKPVAGDGPKKEGEGAPPGGSNSTASKQQATMLPLADEKIEKIEKIFDEMTKNRRIVT 394

Human   373 SGYGM--------GHCLQVKDGTAVKATPANPLPQPPK----DGDAIKKKFV---DRAKR---ID 419
            :...:        |..:..::...:......|.|.||:    :.:..|.|..   :|.||   ||
  Fly   395 TTRRVVRPPLDADGPWIPRQESRIILTPTIAPPPPPPQPAAPEPELPKPKLTPAQERLKRAIYID 459

Human   420 TISRAAFPLAFLIFNIFYWITY 441
            ..||..||..|...|..||..:
  Fly   460 RSSRVLFPALFASLNGIYWCVF 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 153/457 (33%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 3/5 (60%)
ortNP_524406.1 LIC 31..481 CDD:273305 153/457 (33%)
Neur_chan_LBD 38..235 CDD:280998 74/204 (36%)
Neur_chan_memb 243..>334 CDD:280999 48/91 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.