DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and pHCl-2

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_001303470.1 Gene:pHCl-2 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster

Alignment Length:463 Identity:131/464 (28%)
Similarity:207/464 (45%) Gaps:66/464 (14%)


Human    38 PSQTLSPSDFLDKLMGRTSG---YDARIRP---NFKGP--PVNVTCNIFINSFGSVTETTMDYRV 94
            ||...:.|..|.:|:.|.:.   ||..:.|   |..|.  |:::....:|....::..:.:.:.|
  Fly    62 PSLKNAESMALMELLTRLTAPCRYDRMVPPVVHNKDGEEVPMDIYARFYIYVMKNLDSSDLQFTV 126

Human    95 NIFLRQQWNDSRLAYSEY-PDDSLDLDPSMLDS-----IWKPDLFFANEKGANFHDVTTDNKLLR 153
            ...|:.::.|.|||:|.| |:..   .|.|.:|     :|.|.:|..||:.:.....:..::|..
  Fly   127 QGLLQLRYLDPRLAFSSYLPNRR---QPIMGESELKKMLWVPHIFLTNEQASTVLGTSAKDELTS 188

Human   154 ISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTL 218
            |..||.||.|.||..||.|.|:.:.||.|.|.|...|||:.|....:...|.:|.||...:.|.|
  Fly   189 IYPNGTVLTSTRLQATLYCWMNFQKFPFDEQKCKTTLESWMYNTTLVQLHWETDNPVSFDKQLQL 253

Human   219 PQFIL---------KEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWV 274
            .::.|         :...| .|.:.....|.::.|.....|.|::|||:|..::||::||.:|||
  Fly   254 TEYNLIGSLYNESIRVSNE-SYMSHGSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWV 317

Human   275 SFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVN 339
            |||:..|..|||..||.||:|:..|.|.....:|.|||||...::|..||.:|:|.:|:|:|.||
  Fly   318 SFWLQADQTPARTTLGCTTLLSFITLSLSQENNLMKVSYVTMSEVWFLVCTIFIFGSLVEFAFVN 382

Human   340 FVSRQHKEFLRLRRRQKRQNKEEDVTRESRFNFSGY-GMGHCLQVKDGTAVKAT--PANPL---- 397
            .:.|::.:....:|..|...|...|....:....|| .....:.....|::..|  |.|.:    
  Fly   383 TIWRRNNDLQLKKRTTKYIVKSTFVPHLKKHRRHGYRRTDSTMSTMSTTSMDKTCGPNNTVITIE 447

Human   398 -----------------------PQPPKDGDAIKKK----FVDRAKR-----IDTISRAAFPLAF 430
                                   ....:..|:.|:|    |.....:     ||...|..|||:|
  Fly   448 TPIIIGGSLSREDSAISLDEQDETSTSESSDSSKEKPAQTFATMTPKEVSLWIDRKMRFVFPLSF 512

Human   431 LIFNIFYW 438
            ::||..:|
  Fly   513 IVFNALFW 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 128/456 (28%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 1/5 (20%)
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 131/464 (28%)
Neur_chan_LBD 75..297 CDD:280998 61/226 (27%)
Neur_chan_memb 306..520 CDD:280999 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.