DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GLRA2 and GluClalpha

Sequence 1:NP_001112357.1 Gene:GLRA2 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_001287408.1 Gene:GluClalpha FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster

Alignment Length:434 Identity:190/435 (44%)
Similarity:257/435 (59%) Gaps:41/435 (9%)


Human    48 LDKLMGRTSGYDARIRPN----FKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLA 108
            ||:::| ...|||||||:    ..||.| |..|||:.|...:.:.||:|.|.:..|:||.|.||.
  Fly    37 LDQILG-AGKYDARIRPSGINGTDGPAV-VRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLK 99

Human   109 YSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCP 173
            :.:.......|..:..:.:|.|||||:|||..:||::...|..:||..||.||||||::|||:||
  Fly   100 FDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACP 164

Human   174 MDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKEL-GYCTKHYN 237
            |:||.:|:|.|.|::::.|:|:|.|||:|.|....||||.:.|.||:|.|  ||.| .||....|
  Fly   165 MNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTL--EKFLTDYCNSKTN 227

Human   238 TGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSS 302
            ||:::|::|....:|:..|||||:|||..::||:||||||::..|.||||:||:||:|||.||:|
  Fly   228 TGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTS 292

Human   303 GSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSR-------QHKEFLRLRRRQKRQNK 360
            |..||||.|||.||||:|..|||.|||.||||:|.||:.||       .|||.::.:||...|..
  Fly   293 GINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQAS 357

Human   361 EE------DVTRESRFNF-SGYGMGHCLQVKDGTAVKATPANPLP-----------QPPKDGDAI 407
            .:      |....:.|.. |.:..|...|    ..:...|.:||.           |.||..:..
  Fly   358 LDAASDLLDTDSNATFAMASQFARGGGQQ----KPLVRHPGDPLALEKRLQCEVHMQAPKRPNCC 418

Human   408 K---KKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRHED 448
            |   .||..|:||||.|||..|||.|.:||:.||.||.....||
  Fly   419 KTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYLFREEED 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 187/426 (44%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 236..241 3/5 (60%)
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 187/426 (44%)
Neur_chan_LBD 33..241 CDD:280998 90/208 (43%)
Neur_chan_memb 251..452 CDD:280999 89/205 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3644
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 340 1.000 Inparanoid score I2328
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D276914at33208
OrthoFinder 1 1.000 FOG0000367
OrthoInspector 1 1.000 T609454
orthoMCL 1 0.900 OOG5_128286
Panther 1 1.100 LDO PTHR18945
Phylome 1 0.910 0.818 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.